DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and Ucp4A

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster

Alignment Length:339 Identity:102/340 (30%)
Similarity:159/340 (47%) Gaps:48/340 (14%)


  Fly     2 SATSVQEAPKKA-----------VATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG------ 49
            |:||...||...           ..:.|..::...::...|.:...||||.|||:||.|      
  Fly    14 SSTSSNPAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHS 78

  Fly    50 AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKF----- 109
            ||....:||..:.....|..:||.|.|:||:..||.|...|:..|:..|    ||.|::|     
  Fly    79 AGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSY----DLMRKEFTQNGT 139

  Fly   110 QRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLP-VAERRNYTNVANALARITREEGL 173
            |..| :..|...|..|||...::.:||::..|::..:||.. :.|.....:..:|..:|.:..|:
  Fly   140 QALP-VWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGI 203

  Fly   174 TALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLD 238
            ..||:||:|.|.||.:||:..|.:|...| :.....|||.:...:|..||:.:|.:..|...|.|
  Fly   204 KGLWKGSIPNVQRAALVNLGDLTTYDTIK-HLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPAD 267

  Fly   239 IAKTRIQNMKMVDGKPE--------YRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFI 295
            :.||||.|      :|.        |||:.|.|.:...:||..||:|||.|.:.|:.|.::..::
  Fly   268 VVKTRIMN------QPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWL 326

  Fly   296 ILEQLNQ-----GY 304
            ..||:.:     ||
  Fly   327 SFEQIRKMIGASGY 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 32/99 (32%)
Mito_carr 118..207 CDD:278578 27/90 (30%)
Mito_carr 219..307 CDD:278578 32/100 (32%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 95/308 (31%)
Mito_carr 39..138 CDD:278578 33/103 (32%)
Mito_carr 142..239 CDD:278578 28/99 (28%)
Mito_carr 248..336 CDD:278578 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2009952
eggNOG 1 0.900 E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45618
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.