DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and oac1

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_593169.1 Gene:oac1 PomBaseID:SPAC139.02c Length:320 Species:Schizosaccharomyces pombe

Alignment Length:295 Identity:94/296 (32%)
Similarity:141/296 (48%) Gaps:12/296 (4%)


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIG 81
            ||.|||:..||..:..|.:::|||.|:.|    ....|:.|:|.......|...||...|.:|:|
pombe    27 FLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKLDPSKRIYKSVGQAFSLIARHEGIRGLQRGLG 91

  Fly    82 AALLRQATYTTGRLGMYTYLNDLFREKFQRSP---GITDSMAMGTIAGACGAFIGTPAEVALVRM 143
            .|.:.|......|||.|..:.......|...|   .:..::|.|..:|.|||..|:|..:...||
pombe    92 TAYVYQICLNGCRLGFYEPIRRTLNTWFLDDPKGNKLAINVASGAGSGLCGALFGSPFFLVKTRM 156

  Fly   144 TS-DGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRH 207
            .| ..:.||.::..|.::.||.:||.:|.|:..|:.|:...:.|.:..:..||..|:..|....|
pombe   157 QSYSPKFPVGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILRTVSGSSVQLPIYNWAKRMIEH 221

  Fly   208 GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGV 272
            ..| :|||:..|..||.:||.....|....|...||:.|.|   .|..|:...|.:|:..|.||.
pombe   222 YNL-LEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRMYNQK---NKELYKNPIDCILKTIRSEGF 282

  Fly   273 FALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKY 307
            |||:|||..:..|:.|||:.....:||.|:.:.|:
pombe   283 FALYKGFGAHLARIAPHTIFCLTFVEQTNKLFLKF 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 28/92 (30%)
Mito_carr 118..207 CDD:278578 27/90 (30%)
Mito_carr 219..307 CDD:278578 32/88 (36%)
oac1NP_593169.1 PTZ00169 19..295 CDD:240302 86/272 (32%)
Mito_carr 19..117 CDD:278578 28/90 (31%)
Mito_carr 127..223 CDD:278578 28/96 (29%)
Mito_carr 226..316 CDD:278578 34/93 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.