DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and si:ch1073-100f3.2

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_002661286.1 Gene:si:ch1073-100f3.2 ZFINID:ZDB-GENE-131127-11 Length:288 Species:Danio rerio

Alignment Length:285 Identity:100/286 (35%)
Similarity:144/286 (50%) Gaps:12/286 (4%)


  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGI 80
            |...::.|||::...|.....||||:|..:|.    ..:.:.|.:...:| :|..:|..|||.|:
Zfish     4 TRVSRWYFGGIASCAAACCTHPLDLIKVHLQT----QQEVKMRMTGMAVQ-VVRSDGVFALYNGL 63

  Fly    81 GAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTS 145
            .|:|.||.:|:..|..:|..:.|....:.|........:.:....|..|.||||||::..|||.:
Zfish    64 SASLCRQMSYSMTRFAIYETVRDQIASQNQGPMPFYQKILLAAFGGFTGGFIGTPADMVNVRMQN 128

  Fly   146 DGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPL 210
            |.:||...||||.:..:.|.|:.:|||:..|:.|:.....|..:|.:.||:.|.|.|.... |..
Zfish   129 DMKLPPVLRRNYAHALDGLLRVLKEEGIRKLFSGASMAASRGALVTVGQLSCYDQAKQLVL-GTG 192

  Fly   211 QMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFAL 275
            .|.:.|..||.||.::|...|:...|:|:.|||:.|     .|.||||....|....:. |..|.
Zfish   193 LMTDNIFTHFVASFIAGGCATVLCQPMDVVKTRLMN-----SKGEYRGLIHCLSDTGKL-GPKAF 251

  Fly   276 WKGFTPYYCRLGPHTVLTFIILEQL 300
            :||..|...||.||||||||.||||
Zfish   252 YKGLVPAGIRLIPHTVLTFIFLEQL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/93 (29%)
Mito_carr 118..207 CDD:278578 32/89 (36%)
Mito_carr 219..307 CDD:278578 37/83 (45%)
si:ch1073-100f3.2XP_002661286.1 Mito_carr 12..86 CDD:278578 24/79 (30%)
Mito_carr 94..190 CDD:278578 32/97 (33%)
Mito_carr 195..281 CDD:278578 38/89 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.