DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and UBP11

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_013024.1 Gene:UBP11 SGDID:S000001806 Length:717 Species:Saccharomyces cerevisiae

Alignment Length:904 Identity:172/905 (19%)
Similarity:283/905 (31%) Gaps:308/905 (34%)


  Fly     1 MHEYDVNERKEE---------------PASLP-PTQNETTEINSQLRQDQQNQEQENPLRQ--QD 47
            :.:.::|:..|.               |.||. .|:|......::|:.|.|::.....:.:  :|
Yeast    47 LRDLEINQEMEALTAFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRD 111

  Fly    48 NSHPPQENPINQQEKDTLQVSVLYPLVVCAQLADSQLVLTADTPKLSPVKKRQRRVYVADTLRCY 112
            .|                      .::|...||:|..:...       :|::          |.|
Yeast   112 ES----------------------TVIVDRYLAESNGICRT-------IKRK----------RAY 137

  Fly   113 SLRSRQEP------ATKDPLEGGLKQPDVVPPPPPVQAPSPTPTESTEYTPPEQFKSEFWNRIEE 171
            ||..|..|      :..:..:|.|.:       .|.:...||...|.|....|..:....|::|.
Yeast   138 SLPLRPLPVHMASLSIHNKFDGSLHE-------IPNELTKPTNDNSKEDIVRESNQIASSNKLEA 195

  Fly   172 AQEPKPVGKKR--RTPGGLKRTRG-NKLLKELEIQSPETAAAIAAAQAELNAAGKSGAAGARSSR 233
            ..|......|.  ..|..||.:.| :.|.|.|  .||.||..:.:.:.......        ||:
Yeast   196 GSEVAYYTSKEALSKPSYLKLSTGKDALFKTL--SSPATAPPVHSLEVSSQIRD--------SSQ 250

  Fly   234 KRTNTMSLYDRRFQTTTEERRVANGYGGNAARSVTGSSSNEIESQEPQSHQYYGPNGGSNAAGAG 298
            ..::::|..::   ...||.::                 ..|||..|:::..             
Yeast   251 DSSSSLSKVEK---PKEEEGKI-----------------EAIESSAPKAYNL------------- 282

  Fly   299 AGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVY----TLRFAPHFLHNLHHLIQDLNVVQQTIVR 359
            ..:..|...|:.....| |.|..|:||:||::.    |..|...||...:.|..:.|...:.:  
Yeast   283 PVIEDSNDLLSELSITG-LQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEV-- 344

  Fly   360 QQTARSA-SLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKL 423
             |.:||. .|.|.:..                               |||.....:....:.:||
Yeast   345 -QLSRSIYVLFKKMYL-------------------------------NGGRAIIPNRFLKMCKKL 377

  Fly   424 HELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRE--TNQSLIK 486
            .                           .|:|..   :.|||..|||:.||..|.|  :|::::|
Yeast   378 R---------------------------PDLNIP---DDQQDTQEFLLIVLARIHEELSNENVVK 412

  Fly   487 AIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSRKSKRKD 551
            ...:.....||....||                                           ||.:.
Yeast   413 YYPDLVSYDANALQVNP-------------------------------------------SKYEK 434

  Fly   552 EVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVST 616
            ..:.:..|...||:..                     .|...::........|::|.|.|.....
Yeast   435 WYERNVITDGLSPIDH---------------------IYRGQLENILKCQRCGNSSYSYSTFYVL 478

  Fly   617 SAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSC----- 676
            |.|:|      |.|    :.|.|....|::||:.|     |.|:.|.|........|.:|     
Yeast   479 SLAIP------KLS----LYSFTSKSRKIKLEDCI-----NLFTGDEELSGDNAWDCPNCRITDS 528

  Fly   677 ----ETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCITKEYFRGENKYSCNQCTGYTE 737
                |.||.||:       ...|.|:.:......|..:..:...:.:..:...|.:..:.|    
Yeast   529 KSKKEEITSQKK-------KSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKKLT---- 582

  Fly   738 AIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITH 802
            .|:|:.:.|||.:|||.|:||...:.|.::   |..|.|.......:.|   |:..||||..:.|
Yeast   583 TIKSLDFIVLPPILVIHLSRFYYDLTKKNS---TVITYPLILNIILKNG---KVIRYKLYGTVNH 641

  Fly   803 VGATLTVGHYIAYT-------------CFLDLASDYV-NCPKDRRNTMTNSQTMASQAV 847
            .| .|..|||.:..             .::....||: ...|||.|.......|:|..|
Yeast   642 SG-NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEV 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 107/540 (20%)
UBP11NP_013024.1 UCH 297..704 CDD:278850 115/566 (20%)
Peptidase_C19 298..>419 CDD:271592 38/186 (20%)
Peptidase_C19 299..705 CDD:271592 115/564 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.