DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and UBP13

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_009486.3 Gene:UBP13 SGDID:S000000163 Length:747 Species:Saccharomyces cerevisiae

Alignment Length:637 Identity:131/638 (21%)
Similarity:232/638 (36%) Gaps:138/638 (22%)


  Fly   226 AAGARSSRKRTNTMSLYDRRFQTTTEERRVANGYGGNAARSVTGSSSNEIESQEPQSHQYYGPNG 290
            ::|...|.:..|..|.|.:.........:..|.|||    .:|......|.:.:......||   
Yeast    76 SSGLDYSSETCNQGSNYSQDGIFYISNAKAINAYGG----IITQGPEAPILAMKVSDSMPYG--- 133

  Fly   291 GSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQ- 354
                       :||.....:.       |.||:||.|||:       ..|:||..|.:  |::| 
Yeast   134 -----------DGSNKVFGYE-------NFGNTCYCNSVL-------QCLYNLSSLRE--NILQF 171

  Fly   355 --QTIVRQQTARSASLGKN---VSAAQLEHARSWSSKDLATSTDQY--SGQNGGVNSGNGGSGSS 412
              ::....|..:....||.   .:.|..|.:.:.::..|.....|.  .|:...|||.|..:...
Yeast   172 PKKSRESDQPRKKEMRGKKPRIFTEASFEKSIAGTNGHLPNPKPQSVDDGKPTPVNSVNSNTAGP 236

  Fly   413 KSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLN-- 475
                   :||..:.:.:.....:.|:.:...:..:|      ......::.|||...::...|  
Yeast   237 -------SEKKSKFFKSFSAKHVQDNNKKEGSPAIL------TTGKPSSRPQDAPPLIVETPNEP 288

  Fly   476 --CIRETNQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTT 538
              ..|.:.:::.....:.|..|..|.:.|.:....|       |:.|.||:....|.::..|...
Yeast   289 GAPSRLSFENVTDRPPDVPRKIIVGRVLNYENPSRG-------SSNSNNLDLKGESNSSLSTPLD 346

  Fly   539 KTSFFSRKSKRKDEVKP---SKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGAS 600
            |..  :|:|....::.|   .||..::.|:.....:..| :...|.:::...:|...|       
Yeast   347 KKD--TRRSSSSSQISPEHRKKSALIRGPVLNIDHSLNG-SDKATLYSSLRDIFECIT------- 401

  Fly   601 STSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDK--------MRLEERIRELN-- 655
                 .:|..:||||.|:.:..      ...::.:.:.|:.:|.        ..|.|.|...|  
Yeast   402 -----ENTYLTGVVSPSSFVDV------LKRENVLFNTTMHQDAHEFFNFLLNELSEYIERENKK 455

  Fly   656 ---------------LNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQD 705
                           .||.|..|:|.:....|||:|:.||.:.:..||.  |:.:.|.:..|:|:
Yeast   456 IAASDINSDSEPSKSKNFISDLFQGTLTNQIKCLTCDNITSRDEPFLDF--PIEVQGDEETDIQE 518

  Fly   706 KPSTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKV----- 765
            ...:|.|     :|...|.||:.|::|.|..||.|.:..:.||..|.:.|.||... ||.     
Yeast   519 ILKSYHQ-----REMLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFKYS-EKQNCNIK 577

  Fly   766 ---STYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIA 814
               :.:.|.|..:       |..........|:|..::.|:|.....|||::
Yeast   578 LFNNIHYPLTLNV-------CSSINSKVCQKYELAGIVVHMGGGPQHGHYVS 622

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 116/556 (21%)
UBP13NP_009486.3 Peptidase_C19 141..>165 CDD:321984 12/38 (32%)
Peptidase_C19G 388..666 CDD:239128 62/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.