DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and USP38

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_115946.2 Gene:USP38 HGNCID:20067 Length:1042 Species:Homo sapiens

Alignment Length:794 Identity:160/795 (20%)
Similarity:237/795 (30%) Gaps:331/795 (42%)


  Fly   317 LCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHAR 381
            |.|:||:||:|||:..|..|..|                   |:|.   .||..|          
Human   447 LINLGNTCYMNSVIQALFMATDF-------------------RRQV---LSLNLN---------- 479

  Fly   382 SWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADT 446
                               |.|              |:.:||..|:..|...:    .|.|....
Human   480 -------------------GCN--------------SLMKKLQHLFAFLAHTQ----REAYAPRI 507

  Fly   447 LLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRETNQSL-IKA------IGECPEVIANGYIANPD 504
            ...|.:.  ..|....|||..|:|..:|:.:.|..:.| ::|      |.||.|           
Human   508 FFEASRP--PWFTPRSQQDCSEYLRFLLDRLHEEEKILKVQASHKPSEILECSE----------- 559

  Fly   505 EVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTS---------FFSRKSKRKDEVKPSKSTR 560
                         |:.|.:    .|.|...|.|.:||         .|..|.:........:|| 
Human   560 -------------TSLQEV----ASKAAVLTETPRTSDGEKTLIEKMFGGKLRTHIRCLNCRST- 606

  Fly   561 VQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVSTSAALPTP-P 624
                    |......|....|...::||..::..|      .:.|.|....|::  .|::|.| .
Human   607 --------SQKVEAFTDLSLAFCPSSSLENMSVQD------PASSPSIQDGGLM--QASVPGPSE 655

  Fly   625 QATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDI 689
            :...|:.    .:|..:.|.:..|:.|......|:.|:...:...:.|.|.              
Human   656 EPVVYNP----TTAAFICDSLVNEKTIGSPPNEFYCSENTSVPNESNKILV-------------- 702

  Fly   690 SVPVPISGYDNADLQDKPS-------TYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVL 747
                      |.|:..||.       |.:.|..:..|...|:|:|.|..|.....|.:::.....
Human   703 ----------NKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEE 757

  Fly   748 PRLLVIQLNRFSGG---------MEKVSTYVPTTFTLPCFCATC--------------CELGEG- 788
            |..|::.|.|||..         ::.||  :|....||....|.              .:|.|. 
Human   758 PEYLILTLLRFSYDQKYHVRRKILDNVS--LPLVLELPVKRITSFSSLSESWSVDVDFTDLSENL 820

  Fly   789 --------------NKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNS 839
                          .||..|.|.||:.|.|.:...|||.:|.               |..|.|:|
Human   821 AKKLKPSGTDEASCTKLVPYLLSSVVVHSGISSESGHYYSYA---------------RNITSTDS 870

  Fly   840 QTMASQAVPSNENAAPNNGSSSVASTPVIAAASALASSGNILMKKMKFGRSKASS-------SGD 897
               :.|....:|                   |.|||||.:.|:     ||...|:       :.:
Human   871 ---SYQMYHQSE-------------------ALALASSQSHLL-----GRDSPSAVFEQDLENKE 908

  Fly   898 MSK----------------NVKQV--------------------NGIISKNITNGI--------- 917
            |||                :|:::                    ||:...|.|:|:         
Human   909 MSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQHSTNGLSGNNPTSGLWINGDPPLQ 973

  Fly   918 ----------GKLSISTTCQGVNCCAMRLCCTQQTSSSNSTSCSDFSEESLQNGSNSNLSFGGSG 972
                      .||.:..  |.:|..|..|       .:.|.|||     ...||.:.|   ...|
Human   974 KELMDAITKDNKLYLQE--QELNARARAL-------QAASASCS-----FRPNGFDDN---DPPG 1021

  Fly   973 STYPTGYGSTGRGG 986
            |..|||.|  |.||
Human  1022 SCGPTGGG--GGGG 1033

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 113/564 (20%)
USP38NP_115946.2 Peptidase_C19H 446..947 CDD:239129 133/688 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.