DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and UBP9

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_192795.3 Gene:UBP9 AraportID:AT4G10570 Length:923 Species:Arabidopsis thaliana

Alignment Length:994 Identity:188/995 (19%)
Similarity:316/995 (32%) Gaps:371/995 (37%)


  Fly     2 HEYDVNERKEEPASLPPTQNETTEINSQLRQDQQNQ---EQEN----------PLRQQDNSHPPQ 53
            :|....|..|.|...|...::..|.:|.:...|..:   |.|:          .|.:..:..||.
plant    65 NECSTGESSEAPRPGPIDNHDIIESDSDINDPQLRRLLVEGEDYVLVPKQVWKRLVEWYSGGPPI 129

  Fly    54 ENPINQQEKDTLQVSV-LYPLVVCAQLADSQLVLTADTPKLSPVKKRQRRVYVADTLRCYSLRSR 117
            |..:..|...|...|| :|||  |..|.|.              :...|.|          :|..
plant   130 ERKLICQGFYTRSYSVEVYPL--CLMLTDG--------------RDESRTV----------IRLG 168

  Fly   118 QEPATKDPLEGGLKQPDVVPPPPPVQAPSPTPTESTEYTPPEQFKSEFWNRIEEAQEPKPVGKKR 182
            ::.:.::..|             .|.|.:..|.|          |:..|:..::           
plant   169 KQASIRELYE-------------KVCAMTGVPQE----------KAHIWDYFDK----------- 199

  Fly   183 RTPGGLKRTRGNKLLKELEIQSPETAAAIAAAQAELNAAGKSGAAGARSSRKRT-NTMSLY---- 242
                     |.|.||..|..:|.|.::........:...|.|  :.::|:...| |.::|.    
plant   200 ---------RKNGLLDPLSYKSLEESSLHMDQDILVEVDGLS--SSSQSAMSSTGNELALVPLEP 253

  Fly   243 DRRFQTTTEERRVANGYGGNAARSVTGSSS--NEIESQEPQSHQYYGPNGGSNAAGAGAGLNGSA 305
            .|...|......::||:      |.|.:.|  ..|.|::         :|..:.:..|.|..|..
plant   254 SRSIVTIAGGPTLSNGH------STTSNFSLFPRITSED---------DGRDSLSILGKGEKGGL 303

  Fly   306 AALNHAPSMGTLCNIGNSCYLNSVVYTLRFAP----HFLHNLHHLIQ---------DLNVVQQTI 357
            |.|:         |:||:|::||.:..|...|    :||.:....|.         :|.:....:
plant   304 AGLS---------NLGNTCFMNSALQCLAHTPPIVEYFLQDYSDDINRDNPLGMCGELAIAFGDL 359

  Fly   358 VRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEK 422
            ::    :..|.|:|..|     .|::.:| ||....|:||.|         ...|:.....:.:.
plant   360 LK----KLWSSGRNAVA-----PRAFKTK-LARFAPQFSGYN---------QHDSQELLAFLLDG 405

  Fly   423 LHELYNNLH--------------GNEMADSTEPYHADTLLHAIQDV-----------------NA 456
            |||..|.:.              .:|:|:....||.......|.||                 :.
plant   406 LHEDLNKVKRKPYIELKDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPVCGKISI 470

  Fly   457 TF-------------------------EGNQ----------QQDAHEFLMCVLN---CIRETNQS 483
            ||                         :|::          :|.:...|:..|.   |:.|....
plant   471 TFDPFMYLSVPLPSTLTRSMTITVFYCDGSRLPMPYTVIVPKQGSIRDLITALGTACCLAEDESL 535

  Fly   484 L-------------------IKAIGECPEVIANGYIANPDEVDTGE----------GQDRT--DS 517
            |                   :.||.:...::|  |..|  ::..|.          ||:|.  ||
plant   536 LLAEVYDHKIFRYFEIPLDSLSAIKDDEHIVA--YRLN--QIPKGSRKAKLEILHGGQERAVLDS 596

  Fly   518 TASQNLNAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQ-------SPL-KENSPTA-- 572
            ....::........|...|                 :|...|.:.       ||| |.::|:.  
plant   597 VRGSDVKLFGTPFVTYVNT-----------------EPLSGTDIDAVISGFLSPLHKVHAPSKIH 644

  Fly   573 GGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNS 637
            .|......|.||.:                      .|||::|              |.|.|:::
plant   645 NGSDNGHLADATVD----------------------QASGILS--------------SPDTEIDN 673

  Fly   638 ATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCE------TITR----QKQGMLDISVP 692
            |:           .|||:...|.:|..|   |..|.|..|      |:||    ..:|..:    
plant   674 AS-----------DRELSFRIFLTDERG---LNIKPLQSESSISPGTVTRVLVEWNEGEHE---- 720

  Fly   693 VPISGYDNADLQDKPSTYIQN--------------SC----ITKEYFRGENKYSCNQCTGYTEAI 739
                .||::.|.|.|..:..:              ||    :.:|....::.:.|..|..:.:|.
plant   721 ----RYDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQAN 781

  Fly   740 RSISYEVLPRLLVIQLNRFSGG---MEKVSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVIT 801
            :.:....||.:||..|.||:..   ..|:.|:|  .|.:.....:.....:..:.::|:||:|..
plant   782 KKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFV--NFPVHDLDLSKYVKNKNGQSYLYELYAVSN 844

  Fly   802 HVGATLTVGHYIAYTCFLD 820
            |.|. |..|||.||...:|
plant   845 HYGG-LGGGHYTAYAKLID 862

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 126/665 (19%)
UBP9NP_192795.3 UBP12 17..894 CDD:227847 188/995 (19%)
DUSP 38..137 CDD:197831 15/72 (21%)
Peptidase_C19 304..>480 CDD:271592 40/204 (20%)
USP7_C2 505..>566 CDD:291217 8/61 (13%)
Peptidase_C19R <740..893 CDD:239139 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.