DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and usp1

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_012816805.1 Gene:usp1 XenbaseID:XB-GENE-959976 Length:774 Species:Xenopus tropicalis

Alignment Length:895 Identity:214/896 (24%)
Similarity:337/896 (38%) Gaps:225/896 (25%)


  Fly   229 ARSSRKRTNTMSLYDRRFQTTTEERRVANGYGGNAARSVTGSSSNEIESQEPQSHQYYGPNGGSN 293
            ::||..|.|.:||   ||....|.:|...    ....|.|..|.|:.|.:...|.....|.    
 Frog    17 SKSSPPRRNRLSL---RFFQKKETKRALE----FTETSATTESQNDEEKESEISSDQVVPT---- 70

  Fly   294 AAGAGAGLNGSAAALNH---APSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQ 355
                 ..|:..:..:..   .|.:| |.|:||:|||||::..|.:.|.|.:.:..|.:   ::.:
 Frog    71 -----PQLSPPSCCVKKESLIPFVG-LNNLGNTCYLNSILQVLCYCPGFKNGIKLLSE---IISK 126

  Fly   356 TIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVT 420
            .:......|..:..|:.    ::|       :|..|.:.....:..::|         ..|..:|
 Frog   127 KVENLSKEREQTQDKDT----VKH-------ELPASYEVVCSLSSLIHS---------MEHLQIT 171

  Fly   421 EKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRETNQSLI 485
                    .|...|..||........||:.:::||..:||..|.||.|.|.|:|..|:|..|.:.
 Frog   172 --------FLSNPENYDSELAAQPRRLLNTLREVNPMYEGYLQHDAQEVLQCILGNIQEACQVMK 228

  Fly   486 KAI----------------------------GECPEVIANGYIANPDEVDTGE-GQDRTDSTASQ 521
            |.:                            |:...|  ||..|...|::|.| |:.::|:    
 Frog   229 KEMLINSQANDSIKNEQDAAKLETESKGLNGGDIETV--NGSSAEITELETNENGKRKSDN---- 287

  Fly   522 NLNAGNGSLATSQTTTTKTSFFSR----KSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAH 582
              .|||   ...:|..||......    :|||| .:...:..|..:|||.:|        ..:.:
 Frog   288 --EAGN---VKKRTKLTKEPSAEEQRLTRSKRK-SLPEKQDKRTDAPLKSDS--------GNSNN 338

  Fly   583 ATANSLFYLNTV-------------DLSGASSTSGSASTSASGVVSTSAALPTPP---------Q 625
            :...|...||.:             .||..|.:|...|.:.| :.||........         :
 Frog   339 SQKKSKLGLNWLKSGKQPSILSKFCSLSKQSDSSSKCSETQS-IKSTEKISERKKSKENGLGILE 402

  Fly   626 ATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDIS 690
            .||...|.|..|..|......|.|::           |:|.:||.|:||.||:.|.:::...|||
 Frog   403 NTKKGEDTETLSGNVESSGFELVEKM-----------FQGKLVLRTRCLECESFTERREDFQDIS 456

  Fly   691 VPV----PISGYDNAD------LQDKPSTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYE 745
            |||    |....|::|      |:.|...:..:...:.|...||:||.|..|..||||.||:.::
 Frog   457 VPVLESEPPKLEDSSDISPDPRLETKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFD 521

  Fly   746 VLPRLLVIQLNRFS---------GGMEKVSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVIT 801
            .:|.::.|.|..||         ||:.||:|.:.|...|     :..|........:|.|::|:.
 Frog   522 KIPDIVTIHLKCFSANSSEFDCFGGLSKVNTALLTPLNL-----SLEEWSTNQTKDLYGLFAVVM 581

  Fly   802 HVGATLTVGHYIAYTC---FLDLASDYVNCPKDRRNTMTNSQTMASQAVPSNENAAP------NN 857
            |.|.|::.|||.||..   ..||..|::....|.::.:        ||.|.||..|.      ::
 Frog   582 HSGVTISSGHYTAYVRIPEISDLERDHMKALVDHKDVL--------QAEPLNEEEARMSDANYDD 638

  Fly   858 GSSSVASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMSKNVKQVNGIISKNITNGIGKLSI 922
            |..|......:.:||.::......:..:...:||.......:|..|      |:.:.|..|..|.
 Frog   639 GEVSFRVNGCVPSASKVSKKQTDTVSLLGGQKSKPDFQQLPNKTAK------SETVLNSFGDKSY 697

  Fly   923 STTCQGVNCCAMRLCCTQQTSSSNSTSCSDFSEESLQNGSNSNLSFGGSGSTYPTGYGSTGRGGV 987
            |                  .|.|....| |.|::.....:||..||..|...|      .|:   
 Frog   698 S------------------ASFSVDLQC-DKSDKRDCKSANSTFSFLESLKEY------LGK--- 734

  Fly   988 RANYAHGGPDPIWYMCDDDKIKAMTQREFEELLSPTRKITITPYLLFYAR 1037
                        |.:.||.::|...:::|...:||....|.|||||||.:
 Frog   735 ------------WLLFDDSEVKVTEEKDFMTAISPNTLSTSTPYLLFYKK 772

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 146/591 (25%)
usp1XP_012816805.1 Peptidase_C19O 65..771 CDD:239136 198/838 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D210538at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.