DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and USP46

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_073743.2 Gene:USP46 HGNCID:20075 Length:366 Species:Homo sapiens

Alignment Length:535 Identity:95/536 (18%)
Similarity:144/536 (27%) Gaps:253/536 (47%)


  Fly   300 GLNGSAAALNHAPSMGT-------LCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTI 357
            |.|.||...:..|....       |.|.||:||.|||:..|.|...|..|:              
Human    13 GTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENV-------------- 63

  Fly   358 VRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEK 422
                                          ||....|...:|                   :...
Human    64 ------------------------------LAYKAQQKKKEN-------------------LLTC 79

  Fly   423 LHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRETNQSLIKA 487
            |.:|::::...:......|  ....:..::..|..|:...||||||||..:||.|.:..|...| 
Human    80 LADLFHSIATQKKKVGVIP--PKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKK- 141

  Fly   488 IGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSRKSKRKDE 552
                                    |::.           ||.|                      
Human   142 ------------------------QEKQ-----------NGKL---------------------- 149

  Fly   553 VKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVSTS 617
                |:..:..|.:.|.|                                               
Human   150 ----KNGNMNEPAENNKP----------------------------------------------- 163

  Fly   618 AALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQ 682
                                                 .|.:....|:|.:...|:||:|||::.:
Human   164 -------------------------------------ELTWVHEIFQGTLTNETRCLNCETVSSK 191

  Fly   683 KQGMLDISVPVPISGYDNADLQDKPSTYIQNSCIT--------KEYFRGENKYSCNQCTGYTEAI 739
            .:..||:||.|.                 ||:.||        .|....|.||.|..|....||.
Human   192 DEDFLDLSVDVE-----------------QNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQ 239

  Fly   740 RSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTF------TLPCFCATCCELGEGNKLHVYKLYS 798
            :.:..:.||.:|.:.|.||. .||::..|...::      .|..|..:...:   |...:|.|.:
Human   240 KRMRVKKLPMILALHLKRFK-YMEQLHRYTKLSYRVVFPLELRLFNTSSDAV---NLDRMYDLVA 300

  Fly   799 VITHVGATLTVGHYI 813
            |:.|.|:....||||
Human   301 VVVHCGSGPNRGHYI 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 91/528 (17%)
USP46NP_073743.2 Peptidase_C19G 36..363 CDD:239128 90/513 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.