DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp12-46

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_651099.1 Gene:Usp12-46 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster

Alignment Length:567 Identity:116/568 (20%)
Similarity:187/568 (33%) Gaps:217/568 (38%)


  Fly   269 GSSSNEIESQ-----EPQSHQYYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNS 328
            |::.:::|.:     .|.:..|:|                             |.|.||:||.||
  Fly     2 GANVSQLEREIGSDLFPPNEHYFG-----------------------------LVNFGNTCYSNS 37

  Fly   329 VVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTD 393
            |:..|.|...|                   |::..                              
  Fly    38 VLQALYFCKPF-------------------REKVL------------------------------ 53

  Fly   394 QYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHEL-YNNLHGNEMADSTEPYHADTLLHAIQDVNAT 457
            :|..:|             |...:::...|.:| |:.....:...|..|....|.|...::   .
  Fly    54 EYKAKN-------------KRPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKE---E 102

  Fly   458 FEGNQQQDAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQN 522
            |:...||||||||..::|.|.              |:|                      .|.:|
  Fly   103 FDNYMQQDAHEFLNFLINHIN--------------EII----------------------LAERN 131

  Fly   523 LNAGNGS-LATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATAN 586
            ....||: .||:|..:|.....|..||       |.||...:....::..:.|.:...|....||
  Fly   132 AGPSNGNPKATNQGGSTSAMASSIASK-------SSSTSNSNSNSNSTTNSNGNSSNSTGSLNAN 189

  Fly   587 SLFYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERI 651
            :    :.:|.||:.:.:.:...|.:| ..|:.|...|..                         :
  Fly   190 T----SVLDASGSLTATTTPIISGNG-TGTNGANSEPTW-------------------------V 224

  Fly   652 RELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCI 716
            .|:        |:||:...|:||:|||::.:.:...|:.|.|.                 ||:.|
  Fly   225 HEI--------FQGILTSETRCLNCETVSSKDENFFDLQVDVD-----------------QNTSI 264

  Fly   717 T--------KEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGME------KVST 767
            |        .|....:||:.|:.|..|.||.:.:..:.||.:|.:.|.||. .||      |||.
  Fly   265 THCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFK-YMEQFNRHIKVSH 328

  Fly   768 YVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIA 814
            .|.....|..|..:...:   |...:|.|.:|:.|.|:....||||:
  Fly   329 RVVFPLELRLFNTSDDAV---NPDRLYDLTAVVIHCGSGPNRGHYIS 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 111/524 (21%)
Usp12-46NP_651099.1 UCH 23..418 CDD:278850 113/547 (21%)
Peptidase_C19G 25..419 CDD:239128 112/545 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.