DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp8

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_650948.2 Gene:Usp8 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster

Alignment Length:967 Identity:185/968 (19%)
Similarity:297/968 (31%) Gaps:386/968 (40%)


  Fly    22 ETTE--INS-QLRQDQQNQEQENPLRQQ--DNSHPPQENPINQ-------------------QEK 62
            :|.|  ||| :.|..||:|..| |:...  .|.....::||.|                   |||
  Fly    98 DTLEEIINSLRHRYAQQHQAPE-PIAPDLVSNGRAGVDSPITQPTQYARLGLITCQDLYRRMQEK 161

  Fly    63 DTL--------QVSVLYPLVVCAQLADSQLVLTADTPKLSPVKKR------------QRRVYVAD 107
            ..|        .....:....||.....:|:    ||.:|..:.:            .|.|..:.
  Fly   162 SVLVMDCRPSADYEASHLTYYCAFNVPEELI----TPGMSAGRLQARLSSSAKASWASRSVKDSV 222

  Fly   108 TLRCYSLRSRQEPATK-------------DP----------LEGGLKQPDVVPPP----PPVQAP 145
            .|..::.:..| |||.             ||          :|||.:...::.|.    |.||||
  Fly   223 VLMDWNTKDAQ-PATNTAISTLLDILKNWDPDVTYRAPIQIVEGGYEYFIMMYPTHCTNPSVQAP 286

  Fly   146 SPT-----PTESTEY------TPPEQFKSEFWNRIEEAQEPKPVGKKRRTPGGLKRTRGNKLLKE 199
            ...     ..:..||      |..|...::.:       .|:|...:...|..   ||.|:  :.
  Fly   287 QQNNNDIETIDDIEYPSIHDITMKEDISAKDF-------RPRPDFNRANKPAA---TRVNE--QG 339

  Fly   200 LEIQSP--ETAAAIAAAQAELNAAGKSGAAGARSSRKRTNTMSLYDRRFQTTTE--ERRVANGYG 260
            :...||  :..|.|...|||.            ..|...|     |.:.:..::  :|:.|.|.|
  Fly   340 ISRPSPPAKPIAEIMRDQAEF------------LQRAEQN-----DEQLEKASKMWKRQAAEGDG 387

  Fly   261 GNAARSVTGSSSNEIESQEPQSHQYYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCY 325
            .||.           |.||                                              
  Fly   388 LNAT-----------EDQE---------------------------------------------- 395

  Fly   326 LNSVVYTLRFAPHF-LHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLA 389
                       .|| :..|....||. :|:...:|::.:|...| .||: .||......::::: 
  Fly   396 -----------LHFRILQLESKAQDY-IVENNRLREELSRIQEL-HNVT-QQLSQKEVEATRNI- 445

  Fly   390 TSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDV 454
                                 .||...:...::.|||             |....:.||...::.
  Fly   446 ---------------------ESKIRERQRLDEQHEL-------------ERQERERLLAIARET 476

  Fly   455 NATFE----------GNQQQDAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDTG 509
            ...::          |...:|.|        .:.::.:||::..|:....||    .|..|:.| 
  Fly   477 KKHYKSPTPSGPPSPGRNLEDVH--------VVSDSLESLLQLTGDPDPTIA----PNKAEIPT- 528

  Fly   510 EGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGG 574
                                             |.|..|    .:|....|....:::.||..|.
  Fly   529 ---------------------------------FDRAMK----PQPRNVERTSQRVRDFSPVIGQ 556

  Fly   575 ITGAG-TAHATANSLFYLNTVDLSGASSTSG--------------SASTSASG-VVSTSAALPTP 623
            ..|.| |......:..|:|:: |...|:|..              |.|...:| |:...|||...
  Fly   557 NVGRGLTGLKNLGNTCYMNSI-LQCLSNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKE 620

  Fly   624 PQATKY----SSD---------------DEMNS---ATVLKDKMRLE------ERIRELN----- 655
            ....:|    |.|               |:.:|   .|:|.|.:..:      .|.||:.     
  Fly   621 LWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEK 685

  Fly   656 --LNFFSSD-------FEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYI 711
              |.|..:.       |.|.:..|.||::|...:...:...::|:.:|            |::.:
  Fly   686 AWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELP------------PNSNV 738

  Fly   712 --QNSCITKEYFRGE--NKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF------SGGMEKVS 766
              .|.|:.. ||.||  :.::|..|....:||:.:....||.:||:.|.||      ||...|..
  Fly   739 CQLNQCMDM-YFSGERIHGWNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQ 802

  Fly   767 TYVPTTFTL------PCFCATCCELGEGNKL--HVYKLYSVITHVGATLTVGHYIAY 815
            .|:  .|.|      |....     .|...:  ..|:||:|..|.| |:..|||.|:
  Fly   803 NYL--RFPLENLDMNPYIAR-----AESRAVTPKTYQLYAVSNHYG-TMEGGHYTAF 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 113/596 (19%)
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108 6/15 (40%)
RHOD 148..278 CDD:294087 23/135 (17%)
UCH 562..886 CDD:278850 71/313 (23%)
Peptidase_C19R 564..887 CDD:239139 70/311 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127927426
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.