DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and scny

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_729092.1 Gene:scny FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster

Alignment Length:767 Identity:153/768 (20%)
Similarity:258/768 (34%) Gaps:187/768 (24%)


  Fly   426 LYNNLHGNEMA-DSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNC--IRETNQSLIKA 487
            |..:|.||..| .||:...:.      :|.|.:.:.:...:|...||..:..  :...::|:::.
  Fly    18 LRESLGGNSSAGSSTDQAKSG------EDTNGSLQNHIVANAKRILMAKIEYEEVPNYHESVLEN 76

  Fly   488 IGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTK------------T 540
            :.....||..|   ||..::...|::.|......|.:..||:...::....:            |
  Fly    77 LKSKYIVIKPG---NPGAINGFSGKNNTGKLVGANGHDNNGARKQAEHPNNQSHHINHHNHQHPT 138

  Fly   541 SFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAG-GITGAGTA---HATANSLFYL---------- 591
            |..:...|.|..:.|.::.|:.....|.....| |:...|..   ::|..:|.::          
  Fly   139 SNPNELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSE 203

  Fly   592 --NTVDLSGASSTSGS----------ASTSASGVVSTSAALPTPPQATKY----SSDDEMNSATV 640
              :..|.:.|...||.          |:.|....|..........|..|:    ..:|.......
  Fly   204 QAHLADCNVAEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRF 268

  Fly   641 LKDKM------------RLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPV 693
            |.:.|            .|::.::|...  ....|.|.:....:||||..::...|...|:.:.:
  Fly   269 LVEAMERAYLMRFRNYKELDQLVKETTP--LGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDI 331

  Fly   694 PISGYDNAD-LQDKPSTYIQNSCITKEYFRG--------ENKYSCNQCTGYTEAIRSISYEVLPR 749
                 ..|| |:|.              |.|        :..|.|..|.....|.:..|.|..|.
  Fly   332 -----RKADSLEDA--------------FEGHFSRERLEDMGYKCEGCKKKVSATKQFSLERAPI 377

  Fly   750 LLVIQLNRFSGGMEKVSTYV--PTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHY 812
            .|.|||.|||....|::..:  .:...|..:.|. .:..:...| .|:|.|::||:||:...|||
  Fly   378 TLCIQLKRFSMIGNKLTKQISFKSRIDLSKYAAR-SQAAQAQPL-TYRLVSMVTHLGASQHCGHY 440

  Fly   813 IAY-----TCFLDLASDYVNCPKDRRNTMTNSQTM-----ASQAVPSNENAAPN-----NGSSSV 862
            .|.     ..|.:....||..........||:..|     .|||.....| .||     ||.|  
  Fly   441 TAIGSTDTGSFYNFDDSYVRPIAMHSVCNTNAYIMFFELDLSQAASPAAN-RPNGVRLTNGHS-- 502

  Fly   863 ASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMSKNV---KQVNGIISKN-ITNGIGKLSIS 923
             :|||.||..:..|....:..::..|.:...::|:..|..   ||.|....:| :..|.||...:
  Fly   503 -TTPVPAATVSSPSPTRFIGPQLPAGGANGYTNGNAQKTAIQFKQQNQQSPQNGLQLGTGKFQDT 566

  Fly   924 TTCQGVNCCAMRLCCTQQTSSSNSTSCSDFSEESLQNGSNSNLSFGGSGSTYPTGYGSTGRGGVR 988
            .....|...|.....:..|::.|.:|       |..:.|:||                       
  Fly   567 AKPPLVGAHAKGEATSAPTANGNKSS-------SPSSNSSSN----------------------- 601

  Fly   989 ANYAHGGPDPIWYM---CDDDKIK----------------AMTQREFEELLSPTRKITI-----T 1029
                |...:...|:   .||:.|:                .||:...|.......||.:     |
  Fly   602 ----HKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTENHTEPKAKSPVKIQVKTPVKT 662

  Fly  1030 PYLLFYARFDLQPQKATPPMPGSSTTPPPPSSAQS-----SWSNENVSSGSH 1076
            | |.....::...::...|:|.....|....|::|     ..:..:.::|||
  Fly   663 P-LKSLVPYESASEEEEAPLPNPRKRPSGEDSSESDQESGQTNGHSKTNGSH 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 93/466 (20%)
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 68/329 (21%)
UCH 172..477 CDD:278850 67/328 (20%)
Asp-B-Hydro_N <617..>731 CDD:191249 18/99 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127927266
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.