DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp5

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001246589.1 Gene:Usp5 FlyBaseID:FBgn0035402 Length:827 Species:Drosophila melanogaster

Alignment Length:821 Identity:140/822 (17%)
Similarity:235/822 (29%) Gaps:335/822 (41%)


  Fly   199 ELEIQSPETAAAIAAAQAELNAAGKSGAAG-----ARSSRKRTNTMSLYD--RRFQTTTEE---- 252
            ||.::..::..||.||.:.:....|:...|     .|.:.|..:.:...|  :|...:..:    
  Fly   143 ELPMRVTQSVEAILAADSAIAKLEKATLMGTWDGEVRQASKYADNLQQLDNGKRIPPSGWQCEKC 207

  Fly   253 ------------------RRVANGYGGN--------------AAR--SVTGSSSNEIESQEPQSH 283
                              |:..:|.|||              |.:  ::|....:::.|. |:..
  Fly   208 DLTNNLWLNLTDGSIMCGRKFFDGSGGNDHAVEHYRVTGFPLAVKLGTITADGKSDVFSY-PEDE 271

  Fly   284 QYYGP-------NGGSNAA--------------------GAGAGLNGSAAALN--HAPSMGTLCN 319
            ....|       :.|.|.|                    |....|..|.:.|.  ..|....:.|
  Fly   272 MVLDPHLERHLSHFGINMAAMKKSEKSMVELELDINQRIGEWTALTESESELQPVAGPGYTGMRN 336

  Fly   320 IGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWS 384
            :|||||:|||:..|...|.|              ||..|                          
  Fly   337 LGNSCYINSVMQVLFVIPDF--------------QQRFV-------------------------- 361

  Fly   385 SKDLATSTDQY-------SGQNGGVNSGNGGSGSSKSTHQSVTEKLHE----------LYNNLHG 432
                .|..::|       ...:..:.....|:|.....:.|:.|...:          ::.|:.|
  Fly   362 ----GTGAERYFKEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHSTGISPAMFKNIVG 422

  Fly   433 NEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCI--RETNQSLIKAIGECPEVI 495
            ..        |.|            |...|||||::|.:.:|..:  ...||:            
  Fly   423 KN--------HPD------------FSTKQQQDANDFYLHLLTLLDRNSRNQT------------ 455

  Fly   496 ANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSR------KSKRKDEV- 553
                  ||.:......:||.:..||..:.           ..|:..:..|      |:...||| 
  Fly   456 ------NPADALKFLLEDRVECLASHKVK-----------YNTREEYSFRLPVPLDKATNLDEVR 503

  Fly   554 ------KPSKST----------RVQSPLKE--------------NSPTAGGITGAG--TAHATAN 586
                  |.::.|          |.:.||:.              .|...|..|.|.  |..||..
  Fly   504 EFQERKKAARETGQRLPDRDIVRHKVPLQACLERFFGPELIEQFYSTAIGSKTNARKITRLATMP 568

  Fly   587 SLFYLN-----------------TVDLSGASSTSGSASTSASGVVSTSAALPTP-PQATKYSSDD 633
            ....::                 :||:......|.  ..||.|:.....|||.| .:..|::.|:
  Fly   569 DCLMIHVGKFTLGDDWVPKKLDVSVDMPDELDLSN--WRSAGGLQPGEEALPEPATEEVKFAFDE 631

  Fly   634 EMNSATVLKDKMRLEERIRELNLNF---------FSSDFEGIVVLTTKCLSCETITRQKQGMLDI 689
            .:.|..              |.:.|         :.:...|:...:...:  |.|..:     ||
  Fly   632 AVMSEL--------------LTMGFPPEACKRACYHTKNSGLEAASNWLM--EHIADE-----DI 675

  Fly   690 SVPVPISGYDNADLQDKPSTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQ 754
            |.|..:           |:..| ..|...::.......:.....|:.|           |..|..
  Fly   676 SEPFVV-----------PNNSI-GDCAANQFVANPESLAMLMSMGFDE-----------RQAVAA 717

  Fly   755 LNRFSGGMEKVSTYV-------------PTTFTLPCFCA-----TCCELGEGNKLHVYKLYSVIT 801
            |....|.:|:.:.::             |...:.....:     |....|.|.    |:|.:.|:
  Fly   718 LKATDGNVERATDWIFSHADSIGVEDAAPAANSSAAAASSTPNKTNYRDGRGK----YRLVAFIS 778

  Fly   802 HVGATLTVGHYIAYTCFLDLASDYV-----------NCPKD 831
            |:|.:..||||:   |.:....::|           |.|||
  Fly   779 HMGTSAQVGHYV---CHIRKKGEWVIFNDSKVAKSQNPPKD 816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 107/616 (17%)
Usp5NP_001246589.1 UBP14 24..825 CDD:227532 140/822 (17%)
zf-UBP 204..278 CDD:280334 10/75 (13%)
Peptidase_C19B 333..823 CDD:239123 110/631 (17%)
UBA1_UBP5_like 631..674 CDD:270480 6/64 (9%)
UBA2_UBP5 696..737 CDD:270569 7/52 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127927326
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.