DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and DUBAI

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_610784.1 Gene:DUBAI FlyBaseID:FBgn0033738 Length:852 Species:Drosophila melanogaster

Alignment Length:707 Identity:126/708 (18%)
Similarity:218/708 (31%) Gaps:282/708 (40%)


  Fly   284 QYYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQ 348
            |.|.|:  .|.......::.:|.......:...|.|:||:||:|||:..|.....|...:  |:.
  Fly   329 QTYEPS--PNCVALAKAMHENAQPWGRRNARVGLVNLGNTCYMNSVLQALAMTSDFSRQI--LLI 389

  Fly   349 DLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSK 413
            :.|.|....|:||.|             |.|                                  
  Fly   390 ECNSVLLMKVQQQIA-------------LMH---------------------------------- 407

  Fly   414 STHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCI- 477
                      |.|...|..:.:.::|.|              .:|....|||:.|||..:|:.: 
  Fly   408 ----------HSLRYELTPSRVLNATRP--------------PSFTPGLQQDSSEFLGYLLDLLH 448

  Fly   478 -RETNQSLI-----------KAIGECP-----EVIANG---YIANPDEVDTGEGQDRTDSTASQN 522
             .|.|.|.:           :.:.:.|     :::::|   |.:...|:.:|...|         
  Fly   449 EHEINSSSVTGHSVGPPKTGREVDDVPALLSEDILSSGVIPYNSKDHELSSGSNSD--------- 504

  Fly   523 LNAGNGSLATSQTTTTK-TSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATAN 586
             |..:....|...|.|| |:...::.::.|:.||.                              
  Fly   505 -NCNHKPTPTPPATPTKATNGLKQQGQQVDQAKPP------------------------------ 538

  Fly   587 SLFYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERI 651
                 :|:|                                                        
  Fly   539 -----STID-------------------------------------------------------- 542

  Fly   652 RELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPIS----GYDNADLQDKPSTYIQ 712
                     ..|.|.:..|.:||:|...:|.:....::.:..|..    |..|..:||    .|:
  Fly   543 ---------KTFAGKLSTTYRCLNCGWESRNEDSFRELQLSFPDDKEDCGATNYSVQD----LIE 594

  Fly   713 NSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGG---------MEKVSTY 768
            ..| :.|...|:|:|.|.||....:|.|.|.....|:.|::.|.:|...         |.||...
  Fly   595 YYC-SPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKVFHD 658

  Fly   769 VPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRR 833
            ...|..:    :....|.|.:.:| |.||:.:.|.|.::..|||..:.     |....|..|...
  Fly   659 ESVTVKM----SAKDSLQEMSTVH-YDLYAGVVHAGYSMDSGHYFTFA-----ADQAKNWYKFND 713

  Fly   834 NTMTNSQ-----TMASQAVP----------SNENAAPNNGSSSVASTPVIAAASALAS------- 876
            |.:|:|:     .:.|...|          |||:   |:.::|.:|:.|..:...:.|       
  Fly   714 NVVTHSKPEEMHNLTSPNTPYILFYKMCGHSNES---NSVTASCSSSMVSGSNDQVVSVPLSPPL 775

  Fly   877 ---------------SGNILMKKMKFGRSKASSSGDMSKNVKQVNGIISKNITNGIG 918
                           ..::..:::|..|.|..:||       ..|..:|::..:|.|
  Fly   776 KLEELPRRLRDYVRKDNHVYNEELKMQRFKRGNSG-------HGNAFVSRHNFDGDG 825

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 96/546 (18%)
DUBAINP_610784.1 UCH 358..738 CDD:278850 104/578 (18%)
Peptidase_C19H 359..739 CDD:239129 104/578 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127927210
eggNOG 1 0.900 E1_KOG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.