DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp1 and Usp7

DIOPT Version :9

Sequence 1:NP_001263061.1 Gene:Usp1 / 43462 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:95/290 - (32%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 GITGAGTAHATA------NSLFYLNTVDLS------GASSTSGSASTSASGVVSTSAALPTPPQA 626
            |..|.....||.      .:|::.|::.||      .|..:|.|...|...|.. .......|..
  Fly   239 GYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFH-ELQFGDRPVG 302

  Fly   627 TK-------------YSSDDEMNSATVLKDKMR-------LEERIRELNLNFFSSDFEGIVVLTT 671
            ||             :...|......||.||:.       ||..|..|        |||.:....
  Fly   303 TKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGL--------FEGKMSSYI 359

  Fly   672 KCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQ-NSCITKEYFRGENKYSCNQCTGY 735
            ||.:.:..:.:.:...||.:          :::||.:.|.. ...:..|...|:|||... ..|.
  Fly   360 KCKNVDYNSTRYETFYDIQL----------NIKDKKNIYESFQDYVAPETLEGDNKYDAG-VHGL 413

  Fly   736 TEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTT---------------FTLPCFCATCCEL 785
            .||.:.:.:...|.:|.:.|.||.        |.|.|               ..|..:.|.    
  Fly   414 QEASKGVIFTSFPPVLHLHLMRFQ--------YDPVTDSSIKYNDRFEFYEHINLDRYLAE---- 466

  Fly   786 GEGNKLHVYKLYSVITHVGATLTVGHYIAY 815
             ..|.|..|.|::|:.|.|.. ..|||:.:
  Fly   467 -SENTLADYVLHAVLVHSGDN-HGGHYVVF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 63/290 (22%)
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741
COG5077 101..1119 CDD:227409 63/290 (22%)
peptidase_C19C 239..549 CDD:239124 63/290 (22%)
USP7_ICP0_bdg 647..886 CDD:289221
USP7_C2 897..1113 CDD:291217
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.