| Sequence 1: | NP_001263061.1 | Gene: | Usp1 / 43462 | FlyBaseID: | FBgn0028476 | Length: | 1078 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572779.2 | Gene: | Usp7 / 32169 | FlyBaseID: | FBgn0030366 | Length: | 1129 | Species: | Drosophila melanogaster |
| Alignment Length: | 290 | Identity: | 63/290 - (21%) |
|---|---|---|---|
| Similarity: | 95/290 - (32%) | Gaps: | 82/290 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 574 GITGAGTAHATA------NSLFYLNTVDLS------GASSTSGSASTSASGVVSTSAALPTPPQA 626
Fly 627 TK-------------YSSDDEMNSATVLKDKMR-------LEERIRELNLNFFSSDFEGIVVLTT 671
Fly 672 KCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQ-NSCITKEYFRGENKYSCNQCTGY 735
Fly 736 TEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTT---------------FTLPCFCATCCEL 785
Fly 786 GEGNKLHVYKLYSVITHVGATLTVGHYIAY 815 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Usp1 | NP_001263061.1 | Peptidase_C19 | 308..819 | CDD:271592 | 63/290 (22%) |
| Usp7 | NP_572779.2 | MATH_HAUSP | 100..229 | CDD:239741 | |
| COG5077 | 101..1119 | CDD:227409 | 63/290 (22%) | ||
| peptidase_C19C | 239..549 | CDD:239124 | 63/290 (22%) | ||
| USP7_ICP0_bdg | 647..886 | CDD:289221 | |||
| USP7_C2 | 897..1113 | CDD:291217 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45456840 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24006 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||