DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp30

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001284912.1 Gene:Usp30 FlyBaseID:FBgn0029819 Length:558 Species:Drosophila melanogaster

Alignment Length:639 Identity:117/640 (18%)
Similarity:197/640 (31%) Gaps:227/640 (35%)


  Fly   285 YYGPNGG--SNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLI 347
            ::||:|.  ....|..|||:                |.|.:|:||:::..:...|.|:       
  Fly    23 FWGPSGSRLRQRRGQIAGLH----------------NFGLTCFLNTLLQAMAACPQFI------- 64

  Fly   348 QDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSS 412
                                              :|                  :...|..|...
  Fly    65 ----------------------------------AW------------------LQLYNNASPDR 77

  Fly   413 KSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCI 477
            ||...|:...| |:.|..|.....|   ||....:|.|:..:..... .::.||||....:|.|:
  Fly    78 KSLITSMLNTL-EVVNGTHATLRGD---PYSPGAVLRALNALGWVIP-QEEHDAHELFHVLLTCL 137

  Fly   478 RETNQSLIKAIGECPEVIANGYIANPDEVD---------TGEGQDRTDSTASQNLNAGN--GSLA 531
            .|      :||.  |:.:.....|.|.:.|         |..|..|:.|:.:..|.|..  |...
  Fly   138 EE------EAIR--PQPLGCLSDALPTDNDDNSSLAGTATPVGGFRSFSSMAAGLGASQRIGDQP 194

  Fly   532 TSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDL 596
            ...::...|.|.:        ::..:||.:|..::..:.|..  :.|.......|.  .|.:|.|
  Fly   195 NRPSSAMLTDFLN--------MEYDESTSLQRLVRSEAHTPD--SPASVCERDGND--RLGSVLL 247

  Fly   597 SGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSS 661
            ...|    ..:.....:||...:|.||....:.||...:..:...:|: .|..|:..        
  Fly   248 DAVS----PGTPFGFPLVSNPDSLATPMLGGERSSRPRLPQSQQQQDE-GLNRRVSS-------- 299

  Fly   662 DFEGIVVLTTKCLSCETITRQKQG---------MLDISVPVPISG------------------YD 699
                         ||.::.|..:|         |:...|..|..|                  ||
  Fly   300 -------------SCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYD 351

  Fly   700 NAD-----LQDKPSTYIQNSCITKEYFRGE--NKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNR 757
            ..|     |..:..|.:....:..||...|  :...|:.|...|...:|:::..||..|.|.:.|
  Fly   352 KFDSITLNLPPQRRTGLSLGHLLSEYITSEDLSDVKCDSCNETTTHTKSVTFAKLPACLCIHVAR 416

  Fly   758 F----SGGMEKVSTYV---------PTTFTLP--------------CFCATCCEL------GEG- 788
            .    :|.:.|...||         |.:|..|              ...::...:      ||| 
  Fly   417 TVWLPTGQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGF 481

  Fly   789 ---NKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNS 839
               ...::|:|.:|:.|.|.. ..||::.|                ||.::.|:
  Fly   482 GTMFPKNLYRLLAVVVHSGEA-NSGHFVTY----------------RRGSLRNA 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 107/593 (18%)
Usp30NP_001284912.1 Peptidase_C19 39..>139 CDD:271592 31/180 (17%)
UCH <304..547 CDD:278850 44/233 (19%)
Peptidase_C19F <323..548 CDD:239127 41/214 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127927375
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.