DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp1

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001015015.1 Gene:Usp1 RGDID:1306461 Length:784 Species:Rattus norvegicus

Alignment Length:902 Identity:199/903 (22%)
Similarity:340/903 (38%) Gaps:224/903 (25%)


  Fly   229 ARSSRKRTNTMSL--YDRR-------FQTTTEERRVANGYGGNAARSVTGSSSNEIESQEPQSHQ 284
            :|.|..:.|.:||  :.::       |..:.|:...|:.|.|:....|..::.:...|.|.:.  
  Rat    13 SRGSPSKKNRLSLKFFQKKETKRALDFTDSQEDEEKASEYRGSEIDQVVPAAQSSPVSCEKRE-- 75

  Fly   285 YYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQD 349
                                    |..|.:| |.|:||:|||||::..|.|.|.|...:.||   
  Rat    76 ------------------------NLLPFVG-LNNLGNTCYLNSILQVLYFCPGFKAGVKHL--- 112

  Fly   350 LNVVQQTIVRQQTARSASLGKNVSAAQLEHARSW----SSKDLATSTDQYSGQNGGVNSGNGGSG 410
            .|::.:   :::..:..|:.|:..:.:.:...|:    |.:.|..|.:|.             ..
  Rat   113 FNIISR---KKEALKDDSIQKDKGSCKEDPLASYELICSLQSLIISVEQL-------------QA 161

  Fly   411 SSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLN 475
            |.....:..|::|              :|:|..   ||:.::::|..:||..|.||.|.|.|:|.
  Rat   162 SFLLNPEKYTDEL--------------ATQPRR---LLNTLRELNPMYEGYLQHDAQEVLQCILG 209

  Fly   476 CIRETNQSL----IKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTAS-----QNLNAGN---- 527
            .|:||.|.|    ||.:.|....:....:..  |...|.....||||.:     :.|..||    
  Rat   210 NIQETCQLLKKEEIKNLTEFSSKVEEKSLQK--EETGGISSTETDSTRNLDDLKEQLPKGNWKRK 272

  Fly   528 -----GSL-------------------------ATSQTTTTKTSFFSRKSKRKDEVKPS-KSTRV 561
                 |::                         ||..|.........:.....:..||| |.::|
  Rat   273 SDGESGNMKKKVKLSRESQPLEENQRQTRSKRKATGDTLEASPKIIPKCVSENESAKPSQKKSKV 337

  Fly   562 Q----SPLKENSPTAGGITGAG--TAHATANSLFYLNTVDLSGASSTSGSAST-SASGVVSTSAA 619
            :    .|..:...........|  |.:..:.....:|..||.......|..:| :.||..|..::
  Rat   338 KINWLKPATKQPSILSKFCSLGKITTNQRSKGQPKVNEGDLEEDLEKDGRDNTVNGSGPASPGSS 402

  Fly   620 LPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQ 684
            : ||..:::..|               :.:...::........|:|.:||.|:||.||::|.:::
  Rat   403 V-TPVDSSEAKS---------------INKGAEQIGFELVEKLFQGQLVLRTRCLECESLTERRE 451

  Fly   685 GMLDISVPVPISGY----DNADLQDKPSTYIQ------NSCITKEYFRGENKYSCNQCTGYTEAI 739
            ...||||||.....    :::::..:|.|.::      :...:.|...||:||.|..|..||||.
  Rat   452 DFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAE 516

  Fly   740 RSISYEVLPRLLVIQLNRFS----------GGMEKVSTYVPTTFTLPCFCATCCELGEGNKLHV- 793
            ||:.::.:|.::.|.|..|:          ||:.|::|.:.|...|        .|.|.:.... 
  Rat   517 RSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPLKL--------SLEEWSTKPTN 573

  Fly   794 --YKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNSQTMASQAVPSNENAAPN 856
              |.|::|:.|.|.|::.|||.|.....||.|    ...|:.|.:.:......:..|.||..|  
  Rat   574 DSYGLFAVVMHSGITISSGHYTASVKVTDLNS----LELDKGNFVVDQMCEIGKPEPLNEEEA-- 632

  Fly   857 NGSSSVASTPVIAAASALASSGNILMKKM-----KFGRSKASSSGDMSKNVKQVNGIISKNITNG 916
            .|::......|.......|....:|.||.     ..|..|:.:..::.........::....|:.
  Rat   633 RGTAENYDDEVSIRVGGNAQPSKVLNKKNVEGIGLLGGQKSKADYELCSKASNPEKVVGTPFTDS 697

  Fly   917 IGKLSISTTCQGVNCCAMRLCCTQQTSSSNSTSCSDFSEESL-QNGSNSNLSFGGSGSTYPTGYG 980
                                 ...:|:.:|.|..||.|:||. |.|.|.      ||......| 
  Rat   698 ---------------------RNSETNDTNGTQESDRSKESSDQTGINV------SGLENKISY- 734

  Fly   981 STGRGGVRANYAHGGPDPIWYMCDDDKIKAMTQREFEELLSPTRKITITPYLLFYAR 1037
                 .|::...:.|.   |.:.||.::|...:::|...|||:...|.|||||||.:
  Rat   735 -----VVQSLKEYEGK---WLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLFYKK 783

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 136/589 (23%)
Usp1NP_001015015.1 Peptidase_C19 82..>253 CDD:271592 40/175 (23%)
Peptidase_C19O <424..599 CDD:239136 53/198 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4413
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D210538at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1086838
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24006
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.