DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp38

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_003751910.1 Gene:Usp38 RGDID:1311974 Length:1041 Species:Rattus norvegicus

Alignment Length:767 Identity:154/768 (20%)
Similarity:234/768 (30%) Gaps:272/768 (35%)


  Fly   317 LCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHAR 381
            |.|:||:||:|||:..|..|..|...:  |..:||                 |.|....:|:|..
  Rat   447 LINLGNTCYMNSVLQALFMATEFRRQV--LSLNLN-----------------GCNSLMKKLQHLF 492

  Fly   382 SWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADT 446
            ::.:.   |..:.|:.:.  ....:.....:..:.|..:|.|..|.:.||..|.           
  Rat   493 AFLAH---TQREAYAPRI--FFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEEK----------- 541

  Fly   447 LLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRE-TNQSLIKAIGECPEVIANGYIANPDEVDTGE 510
             :..||..:...||         |.|...|::| ||:                 :|.|.|..:..
  Rat   542 -ILRIQSSHKPSEG---------LGCTETCLQEVTNK-----------------VAVPSESPSTG 579

  Fly   511 GQDRTDSTASQNLNAGNGSLAT------SQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENS 569
            |.::|...     ....|.|.|      .::|:.|...|:..|.   ...||.|           
  Rat   580 GSEKTLIE-----KMFGGKLRTHICCLNCRSTSHKVEAFTDLSL---AFCPSPS----------- 625

  Fly   570 PTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVSTSA--ALPTP----PQATK 628
                                    |:.|.....:...|....|::.||.  |...|    |.|..
  Rat   626 ------------------------VEDSSFQDPASLPSAQDDGLMQTSVTDAEEEPVVCNPAAAA 666

  Fly   629 YSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPV 693
            :..|..:|           |.|:....:.|..:....:...:.|.|..:.:.:...|....||  
  Rat   667 FVCDSVVN-----------ERRLGSPPVEFPCAKNSSVPGESAKILVSKDVPQNPGGESTTSV-- 718

  Fly   694 PISGYDNADLQDKPSTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF 758
                           |.:.|..:..|...|||:|.|..|.....|.:::.....|..|::.|.||
  Rat   719 ---------------TDLLNYFLAPEVLTGENQYYCESCASLQNAEKTMQITEEPEYLILTLLRF 768

  Fly   759 SGG---------MEKVSTYVPTTFTLPCFCATCCELGEG-------------------------- 788
            |..         ::.||  :|....||....:...|.||                          
  Rat   769 SYDQKYHVRRKILDNVS--LPLVLELPVKRTSLSSLSEGWSADADFTDVNENLAKKLKPSGTEEA 831

  Fly   789 --NKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNSQTMASQAVPSNE 851
              .||..|.|.||:.|.|.:...|||.:|.               |..|.|.|   :.|..|.:|
  Rat   832 FCPKLVPYLLSSVVVHSGVSSESGHYYSYA---------------RNITGTES---SYQMRPQSE 878

  Fly   852 NAA--PNNGSSSVASTPVIAAASALASSGNILMKKMK-----FGRSKASSSGDMS---------- 899
            :.:  |:..|.....:|.......|.:      |:|.     |..|:.:.:...|          
  Rat   879 SLSLTPSQSSLLGGESPNTVIEQDLEN------KEMSQEWFLFNDSRVTFTSFQSVQKITSRFPK 937

  Fly   900 --------KNVKQVNGIISKNITNGI-------------------GKLSISTTCQGVNCCAMRLC 937
                    |...:.||:.|.|..:|:                   .||.:..  |.:|..|..| 
  Rat   938 DTAYVLFYKKQSRTNGVRSDNPASGVWVNGEPPLQKELMDAITKDNKLYLQE--QELNARARAL- 999

  Fly   938 CTQQTSSSNSTSCSDFSEESLQNGSNSNLSFGGSGSTYPTGYGSTGRGGVRA 989
                  .:.|.|||     ...||.:.|   ...||..|||.|  |.||..|
  Rat  1000 ------QAASASCS-----FRPNGFDDN---DPPGSCGPTGGG--GGGGFNA 1035

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 109/552 (20%)
Usp38XP_003751910.1 UCH 445..945 CDD:278850 125/657 (19%)
Peptidase_C19H 446..946 CDD:239129 125/658 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.