DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and Usp46

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_006250950.1 Gene:Usp46 RGDID:1564808 Length:406 Species:Rattus norvegicus

Alignment Length:588 Identity:101/589 (17%)
Similarity:162/589 (28%) Gaps:278/589 (47%)


  Fly   243 DRRFQTTTEERRVANGYGGNAARSVTGSSSNEIE---SQEPQSHQYYGPNGGSNAAGAGAGLNGS 304
            :|:....|.:..::..:.|:.|.|.|.:|:.|.:   .|.|.:..|:|                 
  Rat    29 NRQLSGLTWDPPLSATFSGHRAFSGTNASALEKDIGPEQFPINEHYFG----------------- 76

  Fly   305 AAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLG 369
                        |.|.||:||.|||:..|.|...|..|:                          
  Rat    77 ------------LVNFGNTCYCNSVLQALYFCRPFRENV-------------------------- 103

  Fly   370 KNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNE 434
                              ||....|...:|                   :...|.:|::::...:
  Rat   104 ------------------LAYKAQQKKKEN-------------------LLTCLADLFHSIATQK 131

  Fly   435 MADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGY 499
            ......|  ....:..::..|..|:...||||||||..:||.|.:..|...|             
  Rat   132 KKVGVIP--PKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKK------------- 181

  Fly   500 IANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSP 564
                        |::.           ||.|                          |:..:..|
  Rat   182 ------------QEKQ-----------NGKL--------------------------KNGNMNEP 197

  Fly   565 LKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKY 629
            .:.:.|                                                           
  Rat   198 AENSKP----------------------------------------------------------- 203

  Fly   630 SSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVP 694
                                     .|.:....|:|.:...|:||:|||::.:.:..||:||.|.
  Rat   204 -------------------------ELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVE 243

  Fly   695 ISGYDNADLQDKPSTYIQNSCIT--------KEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLL 751
                             ||:.||        .|....|.||.|..|....||.:.:..:.||.:|
  Rat   244 -----------------QNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMIL 291

  Fly   752 VIQLNRFSGGMEKVSTYVPTTF------TLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVG 810
            .:.|.||. .||::..|...::      .|..|..:...:   |...:|.|.:|:.|.|:....|
  Rat   292 ALHLKRFK-YMEQLHRYTKLSYRVVFPLELRLFNTSSDAV---NLDRMYDLVAVVVHCGSGPNRG 352

  Fly   811 HYI 813
            |||
  Rat   353 HYI 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 89/521 (17%)
Usp46XP_006250950.1 UCH 74..402 CDD:278850 91/544 (17%)
Peptidase_C19G 76..403 CDD:239128 90/542 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.