DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and ubp9

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_596207.1 Gene:ubp9 PomBaseID:SPBC1703.12 Length:585 Species:Schizosaccharomyces pombe

Alignment Length:644 Identity:118/645 (18%)
Similarity:185/645 (29%) Gaps:290/645 (45%)


  Fly   317 LCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHAR 381
            |.|.||:||::||:.:|.....|..:|:               .....||.........:..|..
pombe    43 LTNYGNTCYVSSVLVSLYHLKPFRDSLN---------------SYPLPSAPPNFKSVCTKTNHPE 92

  Fly   382 SWSS-----KDLATSTDQYSGQNGGVNS------GNGGS----------GSSKSTHQSVTEKLHE 425
            |.||     |.:........|.| |:||      .|.||          |.|..:...:.|.::.
pombe    93 SSSSRHSKKKSMENRKSSLYGSN-GINSCGCVDISNVGSESGTKHQIVVGESNCSAYGMKENIYT 156

  Fly   426 LYNNLHGN-EMAD------STEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRETNQS 483
            ...:|:.: ...|      |.|.:     :..::..|..|...||||||||...:||.:.||   
pombe   157 CLKDLYCSVSCCDCRYGICSPERF-----IQVLRRDNEAFRSTQQQDAHEFFNFLLNSVTET--- 213

  Fly   484 LIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSRKSK 548
                                                                             
pombe   214 ----------------------------------------------------------------- 213

  Fly   549 RKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGV 613
             .||                                    :|.|..|:                 
pombe   214 -LDE------------------------------------YYGNHSDV----------------- 224

  Fly   614 VSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLSCET 678
                                                    ::..:..|.|||.:...||||:||.
pombe   225 ----------------------------------------MHPKWVHSLFEGTLTSETKCLTCEN 249

  Fly   679 ITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCI----TKEYFRGENKYSCNQCTGYTEAI 739
            ||.:.:..||:|:          |:::..|.   .||:    ..|....:||:.|:.|....||.
pombe   250 ITSRDESFLDLSI----------DIENHTSV---TSCLRSFSASEMLSSKNKFHCDVCKSLQEAE 301

  Fly   740 RSISYEVLPRLLVIQLNRF-----SGGMEKVSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSV 799
            :.:..:.||::|.:.|.||     ..|.:|:  :....||......|..|..| |...:|.|.||
pombe   302 KRMKIKKLPKILSLHLKRFKYNETQEGHDKL--FYTIVFTNEMRLFTTTEDAE-NAERMYYLSSV 363

  Fly   800 ITHVGATLTVGHYI--------------------------------------AYTCFLDLASDYV 826
            |.|||.....|||:                                      ||..|...|.:  
pombe   364 IVHVGGGPHRGHYVSIVRTKTYGWVLFDDENVTPVNENYLQRFFGDQPGQATAYVLFYTAADE-- 426

  Fly   827 NCPKDRRNTMTNSQTMASQAVPS---NENAAPNNGSSSVAST---------PVIAAASA 873
              ..|..:.:...:::...::||   .|:...:|.||:..|.         |::|:.|:
pombe   427 --EDDDVSEVDTKESIKPMSIPSQLKQESVEVSNLSSTPRSNSTITYPDMDPMVASFSS 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 106/577 (18%)
ubp9NP_596207.1 UCH 42..421 CDD:278850 106/577 (18%)
Peptidase_C19 42..>67 CDD:271592 10/24 (42%)
Peptidase_C19G 152..422 CDD:239128 78/453 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.