DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and USP12

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_872294.2 Gene:USP12 HGNCID:20485 Length:370 Species:Homo sapiens

Alignment Length:562 Identity:100/563 (18%)
Similarity:156/563 (28%) Gaps:274/563 (49%)


  Fly   269 GSSSNEIE-----SQEPQSHQYYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNS 328
            |::::.:|     .|.|.:..|:|                             |.|.||:||.||
Human    17 GANASALEKEIGPEQFPVNEHYFG-----------------------------LVNFGNTCYCNS 52

  Fly   329 VVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTD 393
            |:..|.|                                            .|.:..|.||    
Human    53 VLQALYF--------------------------------------------CRPFREKVLA---- 69

  Fly   394 QYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATF 458
             |..|              ....:|:...|.:|::::...:......|  ....:..::..|..|
Human    70 -YKSQ--------------PRKKESLLTCLADLFHSIATQKKKVGVIP--PKKFITRLRKENELF 117

  Fly   459 EGNQQQDAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNL 523
            :...||||||||..:||.|.:..|                                         
Human   118 DNYMQQDAHEFLNYLLNTIADILQ----------------------------------------- 141

  Fly   524 NAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSL 588
                                   .:||.|             |:|.....|              
Human   142 -----------------------EERKQE-------------KQNGRLPNG-------------- 156

  Fly   589 FYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRE 653
                                                     :.|:|.|::|  .|...:.|    
Human   157 -----------------------------------------NIDNENNNST--PDPTWVHE---- 174

  Fly   654 LNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCIT- 717
                    .|:|.:...|:||:||||:.:.:..||:||.|.                 ||:.|| 
Human   175 --------IFQGTLTNETRCLTCETISSKDEDFLDLSVDVE-----------------QNTSITH 214

  Fly   718 -------KEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTF-- 773
                   .|....|.||.|.:|....||.:.:..:.||.:|.:.|.||. .|:::..|...::  
Human   215 CLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFK-YMDQLHRYTKLSYRV 278

  Fly   774 TLPCFCATCCELGEG-NKLHVYKLYSVITHVGATLTVGHYIA 814
            ..|.........|:. |...:|.|.:|:.|.|:....|||||
Human   279 VFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIA 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 94/519 (18%)
USP12NP_872294.2 Peptidase_C19G 40..367 CDD:239128 95/540 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.