DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and usp-48

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_492524.2 Gene:usp-48 WormBaseID:WBGene00009267 Length:1262 Species:Caenorhabditis elegans

Alignment Length:371 Identity:75/372 (20%)
Similarity:128/372 (34%) Gaps:100/372 (27%)


  Fly   544 SRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLS------GASST 602
            :::.:.|:|.|..:..|     ..|...||.|.|....:..:....:.|..:..      ..|..
 Worm    85 TQEQETKEEAKKDQKRR-----DLNDQPAGLINGGNFCYVNSFLQVWFNVPEFRQLIYDFRPSEN 144

  Fly   603 SGSASTSASGVVSTSAALPT---PPQATKYSSDDEMNSATVLKDKMRL---EERIRELNLNFFSS 661
            ..........|.:|..||..   ..|.|.::..|:.::   |...:||   ::..:|..|.||::
 Worm   145 FVPPEAPRMNVQATMLALQDIFYTLQTTPFNETDKTSN---LGKLLRLNSEQQDSQEFGLKFFNA 206

  Fly   662 DFEGIVVLTTKCLS-------------------------CETITRQKQGMLDISVPVPISGYDNA 701
                    ..:||.                         |:...|.::....||:.:.|.||  .
 Worm   207 --------LERCLPDHPNGKETLKRLKDLFTGETCTRIVCKCGQRSEREETAISLTLNIEGY--C 261

  Fly   702 DLQDKPSTYIQNSCITKEYFRGE---NKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF---SG 760
            .|.|....|.           ||   :.:.|::|....:..:...|..||.::||||||:   |.
 Worm   262 TLLDALDAYF-----------GEEHLDDFKCSKCNKTGDVSKQSDYVKLPPVIVIQLNRYKYTSK 315

  Fly   761 GMEKVSTYV--PTTFTLPCFCATCCELGEGNKL----HVYKLYSVITHVGATLTVGHYIAYTCFL 819
            |.:|:.|.:  |.......|..|      .|.:    .:|.|::|..|.|.....|||.      
 Worm   316 GRQKLKTPMAYPREIPAKAFQRT------NNSIPPPAEMYDLFAVTIHEGNNAECGHYY------ 368

  Fly   820 DLASDYVNCPKDRRNTMTNSQTMASQAVPSNENAAPNNGSSSVAST 865
                |.:..|.:::....|.:|:  :|:|.    .|.....:.|.|
 Worm   369 ----DLIKSPLNQKWYRYNDETV--EAIPK----PPGTEKPTTAKT 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 66/324 (20%)
usp-48NP_492524.2 UCH 107..392 CDD:278850 67/327 (20%)
Peptidase_C19 109..416 CDD:271592 69/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C297568425
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.