DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and usp35

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_002936594.2 Gene:usp35 XenbaseID:XB-GENE-954095 Length:997 Species:Xenopus tropicalis

Alignment Length:801 Identity:152/802 (19%)
Similarity:251/802 (31%) Gaps:271/802 (34%)


  Fly   241 LYD------RRFQTTTEER-RVANGYGGNAARSVTGSSSNEIESQEPQSHQYYGPNGGSNAAGAG 298
            ||:      |:.....||| :|..|.....|:      .||:.:..|:.           |:.:.
 Frog   394 LYEPIMEAVRKLPVPNEERIKVLLGQNAWTAQ------KNELAAYYPRL-----------ASKSD 441

  Fly   299 AGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTA 363
            .|..|             |.|:||:||:||::..|..|..|.|              .::..:..
 Frog   442 TGKIG-------------LLNLGNTCYMNSILQALFMASDFRH--------------AVLSLKET 479

  Fly   364 RSASLGKNVSA--AQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSG-----SSKSTHQSVTE 421
            .|..|...:..  |.|||:                 |...::..|..:.     .:....|..:|
 Frog   480 HSQPLMMKLQCLFAFLEHS-----------------QRPAISPANFLASFLPPWFTPGVQQDCSE 527

  Fly   422 KLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLM---------CVLNCI 477
            .|..|.:.||..|..       ...:..|:...|::....:...:|..|:         ..:.|:
 Frog   528 YLKYLLDRLHEEEKT-------GKRISQALAQTNSSSGVKKTMASHRTLLEQMFGGRITTKIRCL 585

  Fly   478 RETNQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSF 542
            :      ..::....||..:..:|.|   .|.|...:    ..|.|:||                
 Frog   586 K------CHSVSSREEVFTDLSLAFP---PTNEAAKQ----LPQPLSAG---------------- 621

  Fly   543 FSRKSKRKDEVKPSKS---TRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSG 604
                     |..|.||   .:||.|...|||            .|....:..|       ....|
 Frog   622 ---------ESGPQKSDLTCKVQEPQVTNSP------------ETVRRQWRTN-------DPPPG 658

  Fly   605 SASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVL 669
            ..|..:..|....      |..::..|.|| |:.:::::|..|...::           ||    
 Frog   659 ETSEFSRNVDKAD------PFISRLESQDE-NNCSIVRNKNLLSATLK-----------EG---- 701

  Fly   670 TTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCITKEYFRGENKYSCNQCTG 734
                      |..::|.|.:|           ||        .|..:..|....:|||.|:.|..
 Frog   702 ----------TGGQRGSLSLS-----------DL--------INHFLCPEMLTADNKYRCDTCVS 737

  Fly   735 YTEAIRSISYEVLPRLLVIQLNRFSGGMEKV-------STYVPTTFTLPCFCATCCELGEGNKLH 792
            ..:|.:.:.....|:.|::.|.|||..::.:       :..:|....||...|..    |.|..|
 Frog   738 LQDAEKVVELTTGPQYLILTLLRFSFDLKAMKRRKILDNVSIPLVLKLPIQVAGT----ELNDAH 798

  Fly   793 --------------VYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNSQTMA 843
                          .|.|.|||.|.|.:...|||..|      |.|.:.  ||.|..   ..|..
 Frog   799 FGKDSRCKATKESVTYDLCSVIVHSGLSSETGHYYCY------ARDCLE--KDNRKP---PSTGV 852

  Fly   844 SQAVPSNENAAP------NNGSSSVASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMSKNV 902
            .:..|.......      |:...|.:|...::..::........:...|....:|..|.|:...|
 Frog   853 KKLNPDKHLDLEIQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYKHRPQQAGPSSDLEAAV 917

  Fly   903 KQVNG--IISKNITNGIGKLSISTTCQGVNCCAMRLCCTQQTSSSNSTS-----------CSDFS 954
            ...:|  .:||.:...|.|.:|            :....|:..:.|.::           ..|:.
 Frog   918 ALSHGEVSLSKELMEAISKDNI------------KYLQEQEKEARNRSAYISPLLKSPLWWQDYD 970

  Fly   955 EESLQNGSNSNL--SFGGSGS 973
            ::|..:||:.:|  :.|||||
 Frog   971 KDSDDDGSSGSLGPAGGGSGS 991

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 104/551 (19%)
usp35XP_002936594.2 UCH 445..900 CDD:278850 115/629 (18%)
Peptidase_C19 446..901 CDD:271592 115/629 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.