DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp1 and usp12

DIOPT Version :10

Sequence 1:NP_651687.3 Gene:Usp1 / 43462 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_002941584.2 Gene:usp12 / 100494517 XenbaseID:XB-GENE-1009317 Length:370 Species:Xenopus tropicalis


Alignment Length:52 Identity:14/52 - (26%)
Similarity:20/52 - (38%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IFTALRHGEVCKAIKSVLVSYVRESCPDVQVIVGLEARGFLFSLLIAAELGI 83
            |.|:|....:|.....:|..::....|||.. .|.|.|...|...:...|.|
 Frog    47 ILTSLAISRICLLCVILLDCFILVLYPDVYA-TGKEMRIIDFFWTLTNHLSI 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp1NP_651687.3 Peptidase_C19 308..819 CDD:470612
usp12XP_002941584.2 Peptidase_C19G 40..367 CDD:239128 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.