DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp1 and usp46

Sequence 1:NP_001263061.1 Gene:Usp1 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001231910.1 Gene:usp46 ZFINID:ZDB-GENE-070705-213 Length:370 Species:Danio rerio

Alignment Length:561 Identity:99/562 (18%)
Similarity:155/562 (28%) Gaps:270/562 (48%)


  Fly   269 GSSSNEIE-----SQEPQSHQYYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNS 328
            |::::.:|     .|.|.:..|:|                             |.|.||:||.||
Zfish    13 GTNASALEKDIGPEQFPINEHYFG-----------------------------LVNFGNTCYCNS 48

  Fly   329 VVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTD 393
            |:..|.|...|..|:                                            ||....
Zfish    49 VLQALYFCRPFRENV--------------------------------------------LAYKVQ 69

  Fly   394 QYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATF 458
            |...:|                   :...|.:|::::...:......|  ....:..::..|..|
Zfish    70 QKKKEN-------------------LLTCLADLFHSIATQKKKVGVIP--PKKFISRLRKENDLF 113

  Fly   459 EGNQQQDAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNL 523
            :...||||||||..:||.:.:..|                                         
Zfish   114 DNYMQQDAHEFLNYLLNTVADILQ----------------------------------------- 137

  Fly   524 NAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSL 588
                                   .:||.|             |:|    |.:...|||.||    
Zfish   138 -----------------------EERKQE-------------KQN----GRLKNNGTAIAT---- 158

  Fly   589 FYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRE 653
                                            .|.|:..|                         
Zfish   159 --------------------------------DTEPEQNK------------------------- 166

  Fly   654 LNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCIT- 717
            ::..:....|:|.:...|:||:|||::.:.:..||:||.|.                 ||:.|| 
Zfish   167 IDPTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVE-----------------QNTSITH 214

  Fly   718 -------KEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTF-- 773
                   .|....|.||.|..|....||.:.:..:.||.:|.:.|.||. .||::..|...::  
Zfish   215 CLRDFSNTETLCSEYKYYCEMCCSKQEAQKRMRVKKLPMILALHLKRFK-YMEQLHRYTKLSYRV 278

  Fly   774 TLPCFCATCCELGEGNKL-HVYKLYSVITHVGATLTVGHYI 813
            ..|.........|:...| .:|.|.:|:.|.|:....||||
Zfish   279 VFPLELRLFNTSGDAVNLDRMYDLVAVVVHCGSGPNRGHYI 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 93/518 (18%)
usp46NP_001231910.1 UCH 34..366 CDD:278850 95/541 (18%)
Peptidase_C19G 36..367 CDD:239128 94/539 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.