DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pglym78 and Bpgm

Sequence 1:NP_001034075.1 Gene:Pglym78 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_955414.1 Gene:Bpgm RGDID:735018 Length:258 Species:Rattus norvegicus

Alignment Length:253 Identity:113/254 (44%)
Similarity:173/254 (68%) Gaps:1/254 (0%)


  Fly     4 KYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTL 68
            |::::::||||.:||::|:||.|.|..|:..|.|||...|:.:|....|||:..||:|.|:..|.
  Rat     3 KHRLIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTA 67

  Fly    69 ASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPY 133
            ..||:..|.:.:|::.:|||||||||.|.|||:.:.|..:||.||::||||::..|||:|..||:
  Rat    68 WLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIEESHPF 132

  Fly   134 YENIVKDPRYAEGPKP-EEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVK 197
            :..|..|.||.....| ::.|:.||||..:||.||||.:.|.|::.:||.:||:|||||.|.::|
  Rat   133 FHEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWKERISPEILKGKTVLISAHGNSSRALLK 197

  Fly   198 HLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            ||:.:|::.|:.:.||||:|.:.|||||.:.:...||||::|.::.||:.|..|||.:
  Rat   198 HLEGISDEDIINITLPTGVPILLELDENLRAIRPHQFLGNQEAIQAAIKKVDDQGKVR 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 112/251 (45%)
BpgmNP_955414.1 HP 4..253 CDD:299704 111/249 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D496634at33208
OrthoFinder 1 1.000 FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11931
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.