DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-Ib and man1a2

Sequence 1:NP_651667.1 Gene:alpha-Man-Ib FlyBaseID:FBgn0039634 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001243551.1 Gene:man1a2 ZFINID:ZDB-GENE-070912-390 Length:645 Species:Danio rerio

Alignment Length:572 Identity:192/573 (34%)
Similarity:314/573 (55%) Gaps:55/573 (10%)


  Fly   156 VALPPPDSNKEQDIGGIDILNNV---------------EEPVAQDPAEPLSEGEQ----LEQAIK 201
            |.:|..::.||...|...:::.|               .:.:..|....|.|.::    .::.:|
Zfish    73 VLIPHIETEKESRHGSRQVIHGVGAHDEHRHREEEESLRDKIRADHERALQEAKEKLRKSKEELK 137

  Fly   202 NPLTLGGVSFKEHLKK------IKPI-------LAKGQHFHGATNERQSAVVAAFKHSWAGYKKY 253
            ..:........|.|||      :.|:       :..|......|.|::..:....||:|..|::|
Zfish   138 AEIQTAKAKVSEDLKKKDGPKPLPPVPMPKLVGVNDGDPGDPDTKEKRDKIREMMKHAWDSYRQY 202

  Fly   254 AWGHDNLKPISQYSHEW--FG---LGLTIVDSLDTMYIMGLDDEFKEGRDWVEQSLRFDTKRDVN 313
            .|||:.|||:::..|..  ||   :|.||||:|||:|||||.||||:|::|:||:|.|....:|:
Zfish   203 GWGHNELKPLAKKGHSTNIFGNSQMGATIVDALDTLYIMGLHDEFKDGQEWIEQNLDFSVNAEVS 267

  Fly   314 LFEVTIRVLGGLLSAYHLSGDTMFLAKAAELGNRLLPAFQSPSNIPYSDVNLGDLSAHSPKWSPD 378
            :|||.||.:||||:||:|||..:|..||.:|..:|||||.:|:.||::.|||......:..|:..
Zfish   268 VFEVNIRFIGGLLAAYYLSGQEVFKLKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASG 332

  Fly   379 SST--SEVTTIQLEFRDLSRST-NISIYEQVAHKVNEKVHDLEKNHGLVPIFINANTGTFRNYAT 440
            .|:  :|..|:.:||..|:..| |.:.|::|.| :.:.:..:::.:||.|.::|..||.:..:.|
Zfish   333 GSSILAEFGTLHMEFVHLTYLTGNPAYYQKVMH-IRKLLAKMDRPNGLYPNYLNPRTGRWGQHHT 396

  Fly   441 ISLGARGDSYYEYLLKQWIQTGRKDNDNLILDYMQAVDGVLTQLMRRTPREHWVYIGELINGKDF 505
             |:|..|||:||||||.|:.:.:.|.: ....|..|::.:...|:|:: .....:|||..|| ..
Zfish   397 -SVGGLGDSFYEYLLKAWLMSDKTDAE-ARKTYDDAIEAIERHLIRKS-NGGLTFIGEWKNG-HL 457

  Fly   506 KPKMDHLTCYLPGTLILGHQNGMPDS----HLILARDLLDTCYQTYMMNPTHLAAEISYFALTEK 566
            :.||.||||:..|...|| .:|.||.    :|.|..::..||:::|......|..|...|   :.
Zfish   458 ERKMGHLTCFAGGMFALG-ADGSPDDKAGHYLQLGAEIAHTCHESYDRTVLKLGPEAFKF---DS 518

  Fly   567 DDQDIYVKPNDAHNLLRPEFVESLYYFYSITGNRTYQDMGWKIFQAFETHAKVNAGYTSMGNVKN 631
            ..:.:.|:.|:.:.:||||.:|:.:|.:..|.:..|:..||:..||.:.|.:|:.|::.:.:|.:
Zfish   519 GLEAVAVRQNEKYYILRPEVIETYWYMWRFTHDPKYRQWGWEAAQAIDKHCRVSGGFSGVKDVYS 583

  Fly   632 TQSTRLRDLMESFWMSETLKYFYLLFSDDRKEIDLEQWVFNSEGHPLPVYPL 683
            :..| ..|:.:||:::|||||.|||||.| :.:.||.||||:|.|||||..|
Zfish   584 SNPT-YDDVQQSFFLAETLKYLYLLFSSD-ELLPLENWVFNTEAHPLPVLHL 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IbNP_651667.1 Glyco_hydro_47 242..680 CDD:279825 172/450 (38%)
man1a2NP_001243551.1 Glyco_hydro_47 191..630 CDD:279825 172/450 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D263455at33208
OrthoFinder 1 1.000 FOG0000291
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126925
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R728
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.