DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and SRT1

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_200387.1 Gene:SRT1 AraportID:AT5G55760 Length:473 Species:Arabidopsis thaliana

Alignment Length:548 Identity:155/549 (28%)
Similarity:248/549 (45%) Gaps:140/549 (26%)


  Fly   104 DAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEHDL--SS 166
            |..|:::.|:|:||.:|.::||||.:|||||||:..|||:||.:|||||.::|:|:.:..|  ..
plant    25 DPSHLLQCKIEELAKLIQKSKHLVVFTGAGISTSCGIPDFRGPKGIWTLQREGKDLPKASLPFHR 89

  Fly   167 ANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVYWRQ 231
            |.|:.|||||.||.|..:|..|:|||.||||||||:||..|||:||:.::|:|.:|  .:.|.|.
plant    90 AMPSMTHMALVELERAGILKFVISQNVDGLHLRSGIPREKLSELHGDSFMEMCPSC--GAEYLRD 152

  Fly   232 FDTTEMTARYCHKTHRLC--HRCSEPLYDTIVHFGERGNVKWPLNWAG---------ATANAQRA 285
            |:...:..:   :|.|.|  .:|...|.||:            |:|..         |..:.::|
plant   153 FEVETIGLK---ETSRKCSVEKCGAKLKDTV------------LDWEDALPPKEIDPAEKHCKKA 202

  Fly   286 DVILCLGSSLKVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIASIKINGKCDQV 342
            |::||||:||::           .||        :...||.:||||.||||..|::.|:|..|:|
plant   203 DLVLCLGTSLQI-----------TPACNLPLKCLKGGGKIVIVNLQKTPKDKKANVVIHGLVDKV 256

  Fly   343 MAQLMHLLHIPVPVYTK------------EKDPIFAHASLLMPEELHTLTQ--PLLKNADEEEAF 393
            :|.:|..|::.:|.|.:            ..|..|.:.:|.: ..:|.||.  |.:|:.:     
plant   257 VAGVMESLNMKIPPYVRIDLFQIILTQSISGDQRFINWTLRV-ASVHGLTSQLPFIKSIE----- 315

  Fly   394 TTTTEETQDSTISSESCSFNYSDLPIGKGPRIRTPIKNGRRVKTNLELRQKFKTLNGQDEEI--K 456
                        .|.|.:.||.|..:.|.|.:                 .|.:|...:..:|  |
plant   316 ------------VSFSDNHNYKDAVLDKQPFL-----------------MKRRTARNETFDIFFK 351

  Fly   457 VEHVKTNGEVKTEKDLITLESSIKIETEVKLEKLECSDTNFQQELKLLELLPKLEPLSLKEETEE 521
            |.:......|.|:   ::|....||.||..:|.::       :|..|         .||:|:..|
plant   352 VNYSDGCDCVSTQ---LSLPFEFKISTEEHVEIID-------KEAVL---------QSLREKAVE 397

  Fly   522 TPSNGFPELPKLVAIQKTHAECLSAVPTESRLKPLQLPPLVPIGAPLSTPFVEPKLVLPPASQSS 586
            ..|.|...:.:...:.:..:|.:......|                |.|...:..|:     .:.
plant   398 ESSCGQSGVVERRVVSEPRSEAVVYATVTS----------------LRTYHSQQSLL-----ANG 441

  Fly   587 SIQIKSEGDGDSSTENDNEEEEESELAQ 614
            .::.|.||.|.|...:...:.:...||:
plant   442 DLKWKLEGSGTSRKRSRTGKRKSKALAE 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 93/235 (40%)
SRT1NP_200387.1 SIRT7 45..252 CDD:238701 93/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1503290at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45853
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.