DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and sirt7

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:XP_001336438.3 Gene:sirt7 ZFINID:ZDB-GENE-050208-612 Length:405 Species:Danio rerio

Alignment Length:407 Identity:199/408 (49%)
Similarity:264/408 (65%) Gaps:30/408 (7%)


  Fly    41 KKDNEK------RRRKDAMRRVSMILRKCDSMRTTEDRQFLEKHPDMVKTTKKRKERVEIYKERV 99
            :|:.||      .:::..|:.:|.||:||:|..|.|:|..|:.|.|.|:...:|:.|..:.|.:.
Zfish    15 RKEQEKAKIIQREKQRQTMKTISKILQKCESEWTEEERSMLQAHQDTVQELSRRQNRRHLLKRKQ 79

  Fly   100 VEREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEHDL 164
            .|..|....::.||:|||..:.:|||||.||||||||||.||||||..|:||.||||:.:...||
Zfish    80 EEVFDDAENLKTKVKQLAEAVQRAKHLVIYTGAGISTAASIPDYRGPNGVWTQLQKGRSVSTSDL 144

  Fly   165 SSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVYW 229
            |.|.||.|||:::.||:.:::.||||||||||||||||||::|||:||||::|||.:|.|...:.
Zfish   145 SQAEPTLTHMSIWMLHKMKMVQHVVSQNCDGLHLRSGLPRHALSELHGNMFIEVCDSCSPPREFI 209

  Fly   230 RQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCLGSS 294
            |.||.||.||.:.|.|.|.|..|...|.||||||||||.::.||||.||...|||||:|||||||
Zfish   210 RLFDVTERTALHRHGTGRSCPHCRAELRDTIVHFGERGTLEQPLNWKGAAEAAQRADLILCLGSS 274

  Fly   295 LKVLKKYTWLWQMDRPARQRAKICVVNLQWTPKDAIASIKINGKCDQVMAQLMHLLHIPVPVYTK 359
            |||||||:.||.|:|||.:|.|:.:|||||||||.:|::||:||||.|||.||..|.:.||||::
Zfish   275 LKVLKKYSCLWCMNRPASKRPKLYIVNLQWTPKDNLATLKIHGKCDAVMALLMEELALAVPVYSR 339

  Fly   360 EKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTTEETQDSTISSESCSFNYSDLPIGKGPR 424
            .:||||:.|..|.|:|..:       ::.:|.|..:..||...|.            .|.|:||.
Zfish   340 LQDPIFSMAKPLSPQEQKS-------HSRKEIAPPSALEEVSQSA------------PPQGEGPA 385

  Fly   425 IR-----TPIKNGRRVK 436
            ::     .....|||.|
Zfish   386 VQGGWFGRGYSKGRRKK 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 137/214 (64%)
sirt7XP_001336438.3 SIRT7 104..318 CDD:238701 137/214 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174716389
eggNOG 1 0.900 E1_COG0846
Hieranoid 1 1.000
Homologene 1 1.000 H56152
Inparanoid 1 1.050 413 1.000 Inparanoid score I1774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D468902at33208
OrthoFinder 1 1.000 FOG0007087
OrthoInspector 1 1.000 T1053034
orthoMCL 1 0.900 OOG5_133678
Panther 1 1.100 LDO PTHR45853
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8274
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.