DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and sirt7

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001015815.1 Gene:sirt7 XenbaseID:XB-GENE-1005195 Length:393 Species:Xenopus tropicalis

Alignment Length:401 Identity:193/402 (48%)
Similarity:253/402 (63%) Gaps:26/402 (6%)


  Fly    34 RAKMNPAKKDNEKRR--RKDAMRRVSMILRKCDSMRTTEDRQFLEKHPDMVKTTKKRKERVEIYK 96
            ||:.....::...||  .:|.:|||.:||.|..:.|:.|:.:.|.|..|:|...:||:..||..:
 Frog     3 RAERKAEAREEILRREQNRDRLRRVCVILHKPAADRSPEESELLGKCGDLVHELEKRRLHVERRR 67

  Fly    97 ERVVEREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGE 161
            .|..|..|...::..||.|||.....|:|:|.||||||||||.||||||..|:||||.||:.:..
 Frog    68 HREQEVLDDTDLLREKVLQLAGAFRAAEHVVIYTGAGISTAAAIPDYRGPSGVWTLLNKGRTVNA 132

  Fly   162 HDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNS 226
            .|||.|.||:|||.:..||...|:.|:||||||||||||||||.::||:||||::|||..|.|..
 Frog   133 GDLSEAQPTFTHMCIVRLHSAGLVQHIVSQNCDGLHLRSGLPREAISEVHGNMFIEVCTLCSPQK 197

  Fly   227 VYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCL 291
            .|.|.||.||.||.:.|.|.|.||.|...|.|:||||||||.:..||||.||...:::|||||||
 Frog   198 EYVRLFDVTERTALHRHNTGRFCHNCGAELRDSIVHFGERGKLTQPLNWEGAVQASEKADVILCL 262

  Fly   292 GSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTPKDAIASIKINGKCDQVMAQLMHLLHIPVPV 356
            ||||||||||:.||.|:|...:|.|:.:|||||||||::|::|||||||.||..||..|::.|||
 Frog   263 GSSLKVLKKYSCLWGMNRARARRPKLYIVNLQWTPKDSVATLKINGKCDDVMQILMEELNLNVPV 327

  Fly   357 YTKEKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTTEETQDSTISSESCSFNYSDLPIGK 421
            |.:.:||||   ||.:|  ||         :.||::.|....:|.||          ::.:|..:
 Frog   328 YDRSQDPIF---SLAVP--LH---------SSEEQSHTRKPIKTADS----------HNIIPEQE 368

  Fly   422 GPRIRTPIKNG 432
            .|.:..|:..|
 Frog   369 QPVVEQPVSGG 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 132/214 (62%)
sirt7NP_001015815.1 SIR2 95..309 CDD:320810 132/214 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174720349
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56152
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D468902at33208
OrthoFinder 1 1.000 FOG0007087
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.