DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and Sirt6

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:XP_006513924.1 Gene:Sirt6 MGIID:1354161 Length:390 Species:Mus musculus

Alignment Length:361 Identity:114/362 (31%)
Similarity:168/362 (46%) Gaps:97/362 (27%)


  Fly    79 PDMVKTTKKRKERVEIYKERVV-------------------------EREDAPHVIEAKVEQLAN 118
            |.:....:||.::.::|..|..                         |..|.|..:|.||.:||.
Mouse    31 PSLHHFRRKRPQQGKLYCSRAAAPATMSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELAR 95

  Fly   119 IISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKG-QDIGEHDLSSANPTYTHMALYELHRR 182
            ::.|:..:|.:||||||||:.|||:||..|:||:.::| ....:....:|.|:.|||||.:|.|.
Mouse    96 LMWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERM 160

  Fly   183 RLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVYWRQFDTT------EMTARY 241
            ..|..:||||.||||:|||.||:.|:|:||||:||.|..|:...|.    ||.      :.|.|.
Mouse   161 GFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVR----DTVVGTMGLKATGRL 221

  Fly   242 C--HKTHRLCHRCSEPLYDTIVHFGERGNVKWPLNWAG---------ATANAQRADVILCLGSSL 295
            |  .||..| ..|...|.|||            |:|..         |...::.||:.:.||:||
Mouse   222 CTVAKTRGL-RACRGELRDTI------------LDWEDSLPDRDLMLADEASRTADLSVTLGTSL 273

  Fly   296 KVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIASIKINGKCDQVMAQLM-HL-L 350
            ::           ||:        |:..::.:||||.|..|..|.::|:|..|:||.:|| || |
Mouse   274 QI-----------RPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGL 327

  Fly   351 HIPV----------------PVYTKEKDPIFAHASL 370
            .||.                ||..|.:.|:..:.::
Mouse   328 EIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAV 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 86/240 (36%)
Sirt6XP_006513924.1 SIRT7 101..313 CDD:238701 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.