DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and Sirt6

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_649990.2 Gene:Sirt6 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster

Alignment Length:287 Identity:98/288 (34%)
Similarity:147/288 (51%) Gaps:49/288 (17%)


  Fly   101 EREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQ--DIGEHD 163
            |..|:..|:..|.::||.:|.::.|:|.:|||||||:|.|||:||.:|:|||.:||:  |... .
  Fly    22 ESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWTLEEKGEKPDFNV-S 85

  Fly   164 LSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVY 228
            ...|.||.||||:..|.....:.:|:|||.|||||:|||.|..|||:|||:|:|.||.||     
  Fly    86 FDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCR----- 145

  Fly   229 WRQFDTTEMTARYCHKT-HRLC--------HRC-SEPLYDTIVHFGERGNVKWPLNWAG------ 277
             |||.:.........|: .|.|        ..| |..|||.:            |:|..      
  Fly   146 -RQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSGILYDNV------------LDWEHDLPEND 197

  Fly   278 ---ATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQ---RAKICVVNLQWTPKDAIASIKIN 336
               ...::..||:.:.||::|:::.      ..|.|.:.   ..|..:.|||.|..|..|::.|:
  Fly   198 LEMGVMHSTVADLNIALGTTLQIVP------SGDLPLKNLKCGGKFVICNLQPTKHDKKANLIIS 256

  Fly   337 GKCDQVMAQLMHLLHIPVPVYTKEKDP 363
            ...|.|::::..||.:.:|.|::..||
  Fly   257 SYVDVVLSKVCKLLGVEIPEYSEASDP 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 83/238 (35%)
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 83/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56822122
eggNOG 1 0.900 E1_COG0846
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45853
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.