| Sequence 1: | NP_651664.2 | Gene: | Sirt7 / 43433 | FlyBaseID: | FBgn0039631 | Length: | 771 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_989353.1 | Gene: | sirt6 / 394980 | XenbaseID: | XB-GENE-5929105 | Length: | 331 | Species: | Xenopus tropicalis | 
| Alignment Length: | 368 | Identity: | 123/368 - (33%) | 
|---|---|---|---|
| Similarity: | 177/368 - (48%) | Gaps: | 97/368 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   101 EREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEHDLS 165 
  Fly   166 --SANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVY 228 
  Fly   229 WRQFDTTEMTARYCHK-THRLC--------HRCSEPLYDTIVHFGERGNVKWPLNWAG------- 277 
  Fly   278 --ATANAQRADVILCLGSSLKVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIAS 332 
  Fly   333 IKINGKCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTT 397 
  Fly   398 EETQDSTISSESCSFNYSDLPIGKGPRIRTPIKNGRRVKTNLE 440  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Sirt7 | NP_651664.2 | SIRT7 | 124..338 | CDD:238701 | 86/241 (36%) | 
| sirt6 | NP_989353.1 | SIRT7 | 45..257 | CDD:238701 | 86/241 (36%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1503290at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||