DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and sirt6

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_989353.1 Gene:sirt6 / 394980 XenbaseID:XB-GENE-5929105 Length:331 Species:Xenopus tropicalis


Alignment Length:368 Identity:123/368 - (33%)
Similarity:177/368 - (48%) Gaps:97/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEHDLS 165
            |..|.|..:..||.:||::|.::.::|.:|||||||:..|||:||..|:|||.:||.: .:.|::
 Frog    22 EAFDPPDELCRKVVELADMIRKSSYVVFHTGAGISTSCGIPDFRGPNGVWTLEEKGVN-PKFDIT 85

  Fly   166 --SANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVY 228
              ||.|:.|||||.:|.|..:|..:||||.||||:|||.||..|:|:||||:||.|..|.     
 Frog    86 FESACPSPTHMALLQLQRVGILKFLVSQNVDGLHVRSGFPREQLAELHGNMFVEECSKCS----- 145

  Fly   229 WRQFDTTEMTARYCHK-THRLC--------HRCSEPLYDTIVHFGERGNVKWPLNWAG------- 277
             :|:...::......| |.|||        ..|...|.|||            |:|..       
 Frog   146 -KQYVRDQVVGTMGLKPTGRLCDVPKVRGLRACRGKLKDTI------------LDWEDSLPDRDL 197

  Fly   278 --ATANAQRADVILCLGSSLKVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIAS 332
              |....::||:.:.||:||::           ||:        |:..|:.:||||.|..|..|.
 Frog   198 NLADEACRKADLSITLGTSLQI-----------RPSGNLPLLTKRKGGKLVIVNLQPTKHDKHAD 251

  Fly   333 IKINGKCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTT 397
            ::|:|..|:||.|||.||...:||:|.            ||    |.|:|...|..||..|    
 Frog   252 LRIHGYVDEVMTQLMELLGHKIPVWTG------------MP----TKTEPTNGNYKEENHF---- 296

  Fly   398 EETQDSTISSESCSFNYSDLPIGKGPRIRTPIKNGRRVKTNLE 440
                            |:|..:|..|..:   :.|.:.:.|||
 Frog   297 ----------------YNDSVLGANPNQK---REGCKEEPNLE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 86/241 (36%)
sirt6NP_989353.1 SIRT7 45..257 CDD:238701 86/241 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.