DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and Sirt7

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:XP_008766699.1 Gene:Sirt7 RGDID:1305876 Length:426 Species:Rattus norvegicus

Alignment Length:385 Identity:185/386 (48%)
Similarity:244/386 (63%) Gaps:26/386 (7%)


  Fly    32 ITRAKMNPAKKDNEKR--RRKDAMRRVSMILRKCDSMRTTEDRQFLEKHPDMVKTTKKRKERVEI 94
            ::|::...|::....|  ::::.:|:||.||||..:.|:.|:.:.|.:..|:|...:.|..|.|.
  Rat     7 LSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESEDLVTELQGRSRRREG 71

  Fly    95 YKERVVEREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDI 159
            .|.|..|..|.|..:..||.:||..:..|:|||.||||||||||.||||||..|:|||||||:.:
  Rat    72 LKRRQEEVCDDPEELRRKVRELAGAVRSARHLVVYTGAGISTAASIPDYRGPNGVWTLLQKGRPV 136

  Fly   160 GEHDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVE------- 217
            ...|||.|.||.|||::.:||:.:|:.||||||||||||||||||.::||:|||||:|       
  Rat   137 SAADLSEAEPTLTHMSITQLHKHKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVSSAQRT 201

  Fly   218 -----------------VCKNCRPNSVYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGE 265
                             ||.:|.||..|.|.||.||.||.:.|.|.|.||:|...|.||||||||
  Rat   202 QGLGDKQMSLTVPSLPQVCTSCIPNREYVRVFDVTERTALHRHLTGRTCHKCGTQLRDTIVHFGE 266

  Fly   266 RGNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTPKDAI 330
            ||.:..||||..||..|.:||.||||||||||||||..||.|.:|..:|.|:.:|||||||||..
  Rat   267 RGTLGQPLNWEAATEAASKADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQWTPKDDW 331

  Fly   331 ASIKINGKCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELHTLTQPLLKNADEE 390
            |::|::||||.||..||..|.:.:|||.:.:||||:.|:.|...|..:.::..|..:.||
  Rat   332 AALKLHGKCDDVMRLLMDELGLEIPVYNRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 136/238 (57%)
Sirt7XP_008766699.1 SIRT7 102..339 CDD:238701 147/261 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174718415
eggNOG 1 0.900 E1_COG0846
Hieranoid 1 1.000
Homologene 1 1.000 H56152
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D468902at33208
OrthoFinder 1 1.000 FOG0007087
OrthoInspector 1 1.000 T1087373
orthoMCL 1 0.900 OOG5_133678
Panther 1 1.100 LDO PTHR45853
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.710

Return to query results.
Submit another query.