DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and Sirt6

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001026819.1 Gene:Sirt6 RGDID:1305216 Length:330 Species:Rattus norvegicus

Alignment Length:363 Identity:112/364 (31%)
Similarity:169/364 (46%) Gaps:91/364 (25%)


  Fly   104 DAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQ----DIGEHDL 164
            |.|..:|.||.:||.::.|:..:|.:||||||||:.|||:||..|:||:.::|.    ||   ..
  Rat    25 DPPEELECKVWELARLMWQSSTVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDI---TF 86

  Fly   165 SSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVYW 229
            .:|.|:.|||||.:|.|...|..:||||.||||:|||.||:.|:|:||||:||.|..|:...|..
  Rat    87 ENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRD 151

  Fly   230 RQFDTTEMTARYCHKTHRLC--------HRCSEPLYDTIVHFGERGNVKWPLNWAGATAN----- 281
            ....|..:.|     |.|||        ..|...|.|||            |:|..|..:     
  Rat   152 TVVGTMGLKA-----TGRLCTVAKARGLRACRGELRDTI------------LDWEDALPDRDLTL 199

  Fly   282 ----AQRADVILCLGSSLKVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIASIK 334
                ::.||:.:.||:||::           ||:        |:..::.:||||.|..|..|.:.
  Rat   200 ADEASRTADLSVTLGTSLQI-----------RPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLC 253

  Fly   335 INGKCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTTEE 399
            |:|..|:||.:||..|.:.:|.:...:         ::.:.|..|.:|:...|:.......:.:.
  Rat   254 IHGYVDEVMCKLMKHLGLEIPTWDGPR---------VLEKALPPLPRPVAPKAEPPVHLNGSYKP 309

  Fly   400 TQDSTISSESCSFNYSDLPIGKGPRIRTPIKNGRRVKT 437
            ..||.:                      |.:..:||||
  Rat   310 KPDSPV----------------------PHRPPKRVKT 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 86/243 (35%)
Sirt6NP_001026819.1 SIRT7 45..257 CDD:238701 86/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.