DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt7 and sir-2.4

Sequence 1:NP_651664.2 Gene:Sirt7 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_491733.2 Gene:sir-2.4 WormBaseID:WBGene00004803 Length:292 Species:Caenorhabditis elegans

Alignment Length:277 Identity:75/278 (27%)
Similarity:129/278 (46%) Gaps:33/278 (12%)


  Fly   102 REDAPHVIEAKVEQLANIISQAKH----LVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEH 162
            |:....:|| |:..|.|...|||.    :....|||:||.:.:||:||.||:|||..:|:.....
 Worm    24 RDTETEIIE-KLRTLYNHFVQAKQTGKPIFVLIGAGVSTGSKLPDFRGKQGVWTLQAEGKHAEGV 87

  Fly   163 DLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSV 227
            |...|.|..:|.::..||:...:..:::||.|||..:.|:|...|.|:|||:::|||::|  .|.
 Worm    88 DFQVARPGVSHKSILALHKAGYIKTIITQNVDGLDRKVGIPVEDLIEVHGNLFLEVCQSC--FSE 150

  Fly   228 YWRQFDTTEM----TARYCHKTHRLCHRCSEPLYDTIVHFGERGNVKWPLNWAGATANA-QRADV 287
            |.|:.....:    |.|.|....|....|...|.|..:.:    :.:..||.......| ::...
 Worm   151 YVREEIVMSVGLCPTGRNCEGNKRTGRSCRGKLRDATLDW----DTEISLNHLDRIRKAWKQTSH 211

  Fly   288 ILCLGSSLKVLKKYTWLWQMDRPARQRA-KICVVNLQWTPKDAIASIKINGKCDQVMAQLMHLL- 350
            :||:|:||:::.    :..:...|:.:. |...:|.|.|..:.|....|:.....::..|.:.| 
 Worm   212 LLCIGTSLEIIP----MGSLPLDAKSKGIKTTTINYQETAHEKIVETAIHADVKLILYSLCNALG 272

  Fly   351 -----------HIPVPV 356
                       .:|:|:
 Worm   273 VNVDLGDDLPDEVPIPL 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 63/224 (28%)
sir-2.4NP_491733.2 SIR2 49..259 CDD:294129 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.