DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11837 and DIM1B

Sequence 1:NP_651660.1 Gene:CG11837 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_975003.1 Gene:DIM1B AraportID:AT5G66360 Length:380 Species:Arabidopsis thaliana

Alignment Length:323 Identity:124/324 (38%)
Similarity:181/324 (56%) Gaps:23/324 (7%)


  Fly     7 EKKSRIHNDVQKQGIVFNKDFGQHILKNPLVITTMLEKAALRATDVVLEIGPGTGNMTVRMLERA 71
            |:..||....:..|:...|..|||:|.|..::.:::..:.:|.||.||||||||||:|:::||.|
plant    47 ERDVRIEEKKEHDGLFLCKSKGQHLLTNTRILDSIVRSSDIRPTDTVLEIGPGTGNLTMKLLEAA 111

  Fly    72 KKVIACEIDTRLAAELQKRVQATPLQPKLQVLIGDFLKAELPFFDLCIANVPYQISSPLIFKLLL 136
            :.|:|.|:|.|:...|:|||.......||.::..|.||.:.|.|||.:||:||.|||||:.||:.
plant   112 QNVVAVELDKRMVEILRKRVSDHGFADKLTIIQKDVLKTDFPHFDLVVANIPYNISSPLVAKLVY 176

  Fly   137 HRPLFRCAVLMFQREFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKVESSVVR 201
            ....||.|.|:.|:||:.||:|.|||..:.||::|.:|:|.|..:|.|.|..|.|||||:|||:|
plant   177 GSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLVADVKFVMDVSKREFVPPPKVDSSVIR 241

  Fly   202 LEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFK-VTSVLEMLE-------KNYKLYRSL---R 255
            :.||...|.||..||...||..|.:|||||.:.|: ...|:|:..       .|.::....   .
plant   242 ITPKEIIPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKKKVMELQSLSAGRHGSNVEVMNQTGGDS 306

  Fly   256 NEPIEDDFK------------MQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNSAGIHFN 306
            :..:|:|.|            .:::||.||.......||...:...:.:.||..||.|||.|:
plant   307 DSDVEEDGKDDLLCLDTDASMFKERVIEILRTNGFEEKRPSKLSHRELLHLLSLFNQAGIFFH 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 120/312 (38%)
DIM1BNP_975003.1 AdoMet_MTases 60..368 CDD:302624 120/308 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D963506at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126745
Panther 1 1.100 O PTHR11727
Phylome 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.