DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and dimt1l

DIOPT Version :8

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001003556.2 Gene:dimt1l / 445162 ZFINID:ZDB-GENE-040801-75 Length:306 Species:Danio rerio

Alignment Length:306 Identity:231/307 (75%)
Similarity:264/307 (86%) Gaps:0/307 (0%)


  Fly     1 MPKVTKEKKSRIHNDVQKQGIVFNKDFGQHILKNPLVITTMLEKAALRATDVVLEIGPGTGNMTV 65
            ||||..|||||.|.:|:.|||:||...||||||||||:..::||||||.||||||:|||||||||
Zfish     1 MPKVKAEKKSRTHQEVKSQGIMFNTGIGQHILKNPLVVNGIIEKAALRPTDVVLEVGPGTGNMTV 65

  Fly    66 RMLERAKKVIACEIDTRLAAELQKRVQATPLQPKLQVLIGDFLKAELPFFDLCIANVPYQISSPL 130
            ::||:||||:|||:||||.||||||||.||:|.|||:||||.||.||||||:|:||:|||||||.
Zfish    66 KLLEKAKKVVACELDTRLVAELQKRVQCTPMQNKLQILIGDVLKTELPFFDVCVANLPYQISSPF 130

  Fly   131 IFKLLLHRPLFRCAVLMFQREFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKV 195
            :||||||||.|||||||||||||.|||||||||||||||||||||||||.|||||||||||||||
Zfish   131 VFKLLLHRPFFRCAVLMFQREFAMRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKV 195

  Fly   196 ESSVVRLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKLYRSLRNEPIE 260
            ||||||:|||||||||||.|||||.||||:||||.|:|.||..:|.::||||||::.|:.|..|.
Zfish   196 ESSVVRIEPKNPPPPVNFQEWDGLVRIAFVRKNKMLSAAFKSAAVEKLLEKNYKIHCSVHNIEIP 260

  Fly   261 DDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNSAGIHFN 306
            :||.:..|:.|||:|...:.||||||||||||.||.|||||||||:
Zfish   261 EDFNIAPKIESILQESKFSDKRARSMDIDDFMVLLHAFNSAGIHFS 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 220/289 (76%)
dimt1lNP_001003556.2 PTZ00338 16..305 CDD:240367 220/289 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C23820983
eggNOG 1 0.900 E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7047
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D240437at33208
OrthoFinder 1 1.000 FOG0004194
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126745
Panther 1 1.100 LDO PTHR11727
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R317
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.