DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11837 and Tfb2m

Sequence 1:NP_651660.1 Gene:CG11837 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_032275.2 Gene:Tfb2m MGIID:107937 Length:396 Species:Mus musculus

Alignment Length:324 Identity:66/325 (20%)
Similarity:124/325 (38%) Gaps:100/325 (31%)


  Fly    25 KDFGQHILKNPLVITTMLEKAALRATDVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAELQK 89
            :|..:|  :||             :..::||..||.|.:|..:|:...:|:|.|.:......|: 
Mouse    85 RDLLEH--QNP-------------SRQIILECNPGPGILTGALLKAGARVVAFESEKTFIPHLE- 133

  Fly    90 RVQATPLQ----PKLQVLIGDFLK--------------AELPFFDLCIANVPYQISSPL-IFKLL 135
                 |||    .:|||:..||.|              ::..|.:|.|..||:....|: :|.:|
Mouse   134 -----PLQRNMDGELQVVHCDFFKMDPRYQEVVRPDVSSQAIFQNLGIKAVPWSAGVPIKVFGIL 193

  Fly   136 LHR-----------PLFRCAVL---------MF--QREFAERLVAKP-GDKLYCRLSINTQLLAR 177
            .::           .|:.|..:         ||  ::|| .:|:|.| ...||..:::..|:...
Mouse   194 PYKHERRILWKILFDLYSCESIYRYGRVELNMFVSEKEF-RKLIATPKRPDLYQVMAVLWQVACD 257

  Fly   178 VDMLMKVGKNNFRPPPK---VESS--------------VVRLEPKNP-----PPPVNFTEWDGLT 220
            |..|.....::|....:   :|.|              :||:.|:..     ..|:|:..:..|.
Mouse   258 VKFLHMEPWSSFSVHTENGHLEKSKHGESVNLLKQNLYLVRMTPRRTLFTENLSPLNYDIFFHLV 322

  Fly   221 RIAFLRKNKTLAATFKVTSVLEMLEKNYKLYRSLRNEP-------IEDDFKMQDKVISILEEQD 277
            :..|.::|..:....:..|.::.:    .:.|.:|..|       ...|||   |:...:|:.:
Mouse   323 KHCFGKRNAPIIRHLRSLSTVDPI----NILRQIRKNPGDTAARMYPHDFK---KLFETIEQSE 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 66/325 (20%)
Tfb2mNP_032275.2 AdoMet_MTases 81..377 CDD:302624 66/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.