DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slu7 and SMP2

DIOPT Version :8

Sequence 1:NP_651659.2 Gene:Slu7 / 43427 FlyBaseID:FBgn0039626 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_568017.1 Gene:SMP2 / 829866 AraportID:AT4G37120 Length:536 Species:Arabidopsis thaliana

Alignment Length:571 Identity:238/572 (42%)
Similarity:318/572 (56%) Gaps:71/572 (12%)


  Fly    29 KSREDWRKAKELEEARKAGTAPAAVDEEGRDINPHIPQYISNAPWYYGSAGPTLKHQRP-QHEDE 92
            |||||.||..|||||||||.|||.|||:|::||||||:|:|.||||..|..|:||||:. :.|.|
plant     9 KSREDHRKKLELEEARKAGLAPAEVDEDGKEINPHIPEYMSKAPWYLKSEQPSLKHQKNWKIEPE 73

  Fly    93 QGQLDKRAPKGLNTARIITKFRKGACENCGAVTHKRKDCLERPRKVQAKYAESIVVHDEHLVNEA 157
            ..::.....|.:..|.   ::|||||.||||:||..|.|::||||:.|||....:..||. :...
plant    74 PKKIWYDRGKKIYQAE---QYRKGACINCGAMTHSSKACMDRPRKIGAKYTNMNIAADEK-IESF 134

  Fly   158 AVNYDEKRDRWSSYDPANHREIIEEYEKVEEA-KRQLKAEKLK---------NDPDAEISDEEGN 212
            .::||.|||||:.||.:.:|.:::.|:..||| |:.||.::||         |..||....||..
plant   135 ELDYDGKRDRWNGYDTSTYRHVVDRYDAKEEARKKYLKEQQLKKLEEKNNNENGDDATSDGEEDL 199

  Fly   213 EDKYVDE--VD----MPGTKVDSKQRI-------TVRNLRIREDTAKYLRNLDPNSAYYDPKTRS 264
            :|..|||  ||    |...||:.:.|.       |||||||||||||||.|||.|||:|||||||
plant   200 DDLRVDEAKVDESRQMDFAKVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAHYDPKTRS 264

  Fly   265 MRDNPNPAVPEEEAEFAGENFVRFSGDTTAQATAQLFAWEAHGKGVDVHLLAEPTKLELLQKEYE 329
            ||::|.|.....|..:.|:|..|.||.........:.:.||..||.|:|:.|.|::.|||.|.::
plant   265 MREDPLPDADPNEKFYLGDNQYRNSGQALEFKQINIHSCEAFDKGHDMHMQAAPSQAELLYKNFK 329

  Fly   330 QKKEQFKSSTKTHIVEKYGGEEHLQVPPKSLLLAQTEEYIEYSRSGKVIKGVEKPKARSIYEEDV 394
            ..||:.|:.||..|:||||........|..|||.|:|..|||.|:|:::||.|....:|.|||||
plant   330 VAKEKLKTQTKDTIMEKYGNAATEGEIPMELLLGQSERQIEYDRAGRIMKGQEVIIPKSKYEEDV 394

  Fly   395 YINNHTTVWGSFWNAGRWGYKCCKSFIKNSYCVGMQEPEGYSEHHSTSSTAAATTEPAAQSQFKV 459
            :.||||:||||:|...:||||||:..|:||||.|                 :|..|.|..|    
plant   395 HANNHTSVWGSWWKDHQWGYKCCQQTIRNSYCTG-----------------SAGIEAAEAS---- 438

  Fly   460 PEVPPERPTSEVDSASSSEPSSSEEEEVKPEKKKTKKKSKKREKKKKAKEQRKQKGKNKETKDKD 524
                     .::..|:.:...:|:|...|.|:||.........:..:..|:.......||  |..
plant   439 ---------IDLMKANIARKEASKESPKKVEEKKMATWGTDIPEDLELNEEALANALKKE--DLS 492

  Fly   525 KTKEKDIPEELDDRKRAYNSMY--DVKAPTEDEIEEWKKKRPRAEDPMLQF 573
            :.:||      |:|||.||..|  ||   |.:|:|.::.||...||||..|
plant   493 RREEK------DERKRKYNVNYTNDV---TSEEMEAYRMKRVHHEDPMRNF 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slu7NP_651659.2 Slu7 160..405 CDD:288545 121/268 (45%)
SMP2NP_568017.1 Slu7 136..405 CDD:288545 121/269 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4690
Inparanoid 1 1.050 396 1.000 Inparanoid score I467
OMA 1 1.010
OrthoDB 1 1.010 D816947at2759
OrthoInspector 1 1.000 T124683
orthoMCL 1 0.900 OOG5_128138
Panther 1 1.100 O PTHR12942
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.