DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slu7 and SLU7

DIOPT Version :8

Sequence 1:NP_651659.2 Gene:Slu7 / 43427 FlyBaseID:FBgn0039626 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001351446.1 Gene:SLU7 / 10569 HGNCID:16939 Length:601 Species:Homo sapiens

Alignment Length:596 Identity:305/597 (51%)
Similarity:385/597 (64%) Gaps:61/597 (10%)


  Fly    15 LSKHDQDAEEEPKKKSREDWRKAKELEEARKAGTAPAAVDEEGRDINPHIPQYISNAPWYYG-SA 78
            ||...:.:.|||||.:||||||.|||||.||.|.|||.|||||:|||||||||||:.|||.. |.
Human    29 LSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSK 93

  Fly    79 GPTLKHQRPQHEDEQ-----GQLDKRAPKGLNTARIITKFRKGACENCGAVTHKRKDCLERPRKV 138
            .|||||||||.|.::     |:..||   |:....||||:||||||||||:|||:|||.||||:|
Human    94 RPTLKHQRPQPEKQKQFSSSGEWYKR---GVKENSIITKYRKGACENCGAMTHKKKDCFERPRRV 155

  Fly   139 QAKYAESIVVHDEHLVNEAAVNYDEKRDRWSSYDPANHREIIEEYEKVEEAKRQLKAEKLK---- 199
            .||:..:.:..|||:..:...:||.|||||:.|:|..|.:|:|||.||:.|||.|||:||:    
Human   156 GAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELA 220

  Fly   200 --------NDPDAEISDEEGN-------------EDKYVDEVDMPGTKVDSKQRITVRNLRIRED 243
                    |.|..:..:||.|             ||||.|::||||...|||:||||||||||||
Human   221 SGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLRIRED 285

  Fly   244 TAKYLRNLDPNSAYYDPKTRSMRDNP--NPAVPEEEAEFAGENFVRFSGDTTAQATAQLFAWEAH 306
            .|||||||||||||||||||:||:||  |.....:|..:||:||||::|||.:.|..|||||||:
Human   286 IAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAY 350

  Fly   307 GKGVDVHLLAEPTKLELLQKEYEQKKEQFKSSTKTHIVEKYGGEEHLQVPPKSLLLAQTEEYIEY 371
            .||.:|||.|:|||||||.|.::.|||.||...|..|:|||||:|||..||..|||||||:|:||
Human   351 DKGSEVHLQADPTKLELLYKSFKVKKEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEY 415

  Fly   372 SRSGKVIKGVEKPKARSIYEEDVYINNHTTVWGSFWNAGRWGYKCCKSFIKNSYCVGMQEPEGYS 436
            ||.|.||||.|:..|.|.|||||.|:|||.:|||:|..||||||||.||.|.|||.|....|   
Human   416 SRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKE--- 477

  Fly   437 EHHSTSSTAAATTEPAAQSQFKVPEVPPERPTSEVDSASSSEPSSSEEEEVKPEKKKTKKKSKK- 500
               ..:|......|...:...|.|:...|                ..:|::|.||||.|||.|| 
Human   478 ---IVNSEECIINEITGEESVKKPQTLME----------------LHQEKLKEEKKKKKKKKKKH 523

  Fly   501 REKKKKAKEQRKQKGKNKETKDKDKTKEKDIPE--ELDDRKRAYNSMYDVKAPTEDEIEEWKKKR 563
            |:....:.::.|:..|.|:..:.::.:...:.|  ::|:|||.|||||:.:.|||:|:|.::.||
Human   524 RKSSSDSDDEEKKHEKLKKALNAEEARLLHVKETMQIDERKRPYNSMYETREPTEEEMEAYRMKR 588

  Fly   564 PRAEDPMLQFM 574
            .|.:|||..|:
Human   589 QRPDDPMASFL 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slu7NP_651659.2 Slu7 160..405 CDD:288545 157/272 (58%)
SLU7NP_001351446.1 Slu7 176..449 CDD:314553 157/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C252255989
eggNOG 1 0.900 E1_KOG2560
Hieranoid 1 1.000
Homologene 1 1.000 H4690
Inparanoid 1 1.050 578 1.000 Inparanoid score I1016
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D192250at33208
OrthoFinder 1 1.000 FOG0003584
OrthoInspector 1 1.000 T1073745
orthoMCL 1 0.900 OOG5_128138
Panther 1 1.100 LDO PTHR12942
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1349
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.