DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and Apmap

DIOPT Version :8

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_082253.1 Gene:Apmap / 71881 MGIID:1919131 Length:415 Species:Mus musculus

Alignment Length:413 Identity:136/414 (33%)
Similarity:216/414 (52%) Gaps:50/414 (12%)


  Fly     1 MGFLAALLKTSLFLVLFLGSLFLLPVLYPSTTFPFEQYFIKPARDLNGTLELNNHLNGARKLWKD 65
            |.||  :|..||.:.| ||::.||.......:|.|     |....:.|.|..|..|..|.:|:::
Mouse    40 MTFL--MLAVSLAIPL-LGAMMLLESPIDPQSFSF-----KEPPFMFGVLHPNTKLRQAERLFEN 96

  Fly    66 QIFGPECLIVLEDKIYTGIHSGEVIRLNNEESVQPITKIGQ-PCDYIFDDELCGYPVGLALDTQG 129
            |:.|||.::.:.|.::||...|.|::|.|.| ::.|.:.|. ||....|:..||.|:|:.....|
Mouse    97 QLSGPESIVNIGDVLFTGTADGRVVKLENGE-IETIARFGSGPCKTRDDEPTCGRPLGIRAGPNG 160

  Fly   130 NNLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQG-DIFWTDSFSE- 192
             .|.|.|||.|:::|:.:.:...:|:.:|..:.||    :....|.|.::|.| .|::|||.|: 
Mouse   161 -TLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGK----KMSFVNDLTVTRDGRKIYFTDSSSKW 220

  Fly   193 ---DFVFAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYL 253
               |::.... |...|||..||.|.|..:||||:|.|.||:.|||.|||:::||||..|:||.|:
Mouse   221 QRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYV 285

  Fly   254 KGSRAGESEVFVEGLPGCPDNL-TADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVAL 317
            .|...|.:::|||.:||.|||: .:...|.||  :.|:...||. |::|       .||:....:
Mouse   286 SGLMKGGADMFVENMPGFPDNIRPSSSGGYWV--AAATIRANPG-FSML-------DFLSDKPFI 340

  Fly   318 MRLPLRVLNHIYPNDIAARLFHSFN-DLVIRNAPKRSTVVRVDWNGNIVRSLHGFD-RSASGISH 380
            .|:                :|..|: :.|::..|:.|.|:.|..:|...||||..| :..:.:|.
Mouse   341 KRM----------------IFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSE 389

  Fly   381 VLEVKGHLYLGSPFNHYVAKVKL 403
            ..|..|:|||||..:.::.::.|
Mouse   390 AHEHDGYLYLGSFRSPFICRLSL 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 80/212 (38%)
Str_synth 174..256 CDD:304606 41/88 (47%)
ApmapNP_082253.1 YvrE 72..>319 CDD:225921 93/255 (36%)
NHL 95..>283 CDD:302697 72/194 (37%)
NHL repeat 101..136 CDD:271320 12/36 (33%)
NHL repeat 151..189 CDD:271320 12/39 (31%)
NHL repeat 199..247 CDD:271320 18/48 (38%)
Str_synth 200..287 CDD:304606 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C267906218
eggNOG 1 0.900 E1_COG1185
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4032
Isobase 1 0.950 0 Normalized mean entropy S5287
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002859
OrthoInspector 1 1.000 T616431
orthoMCL 1 0.900 OOG5_130023
Panther 1 1.100 O PTHR10426
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3581
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.