DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and apmap

DIOPT Version :8

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_997773.1 Gene:apmap / 266637 ZFINID:ZDB-GENE-020919-1 Length:415 Species:Danio rerio

Alignment Length:411 Identity:122/412 (30%)
Similarity:196/412 (48%) Gaps:56/412 (14%)


  Fly    10 TSLFLVLFLGSLFLLPVLYPSTTFPFEQYFIKPARDLN------GTLELNNHLNGARKLWKDQIF 68
            |.|.:|.||    |||:|.  ..|..|.........||      |..|.|..|..|.:|:::::.
Zfish    41 TLLTMVAFL----LLPLLV--VVFVLESPIQPEVFSLNEPPLMTGCYEPNLKLRQAERLFEERLV 99

  Fly    69 GPECLIVLEDKIYTGIHSGEVIRLNNEESVQPITKIGQ-PCDYIFDDELCGYPVGLALDTQGNNL 132
            |||.|..:.|..|||...|:::::.. .::..:..||: ||.....:..||.|:|:.:...| .|
Zfish   100 GPESLANIGDVFYTGTADGKIVKIEG-RNIHVLATIGKPPCGSREHEHTCGRPLGIRVGPNG-TL 162

  Fly   133 IVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQG-DIFWTDSFS----E 192
            .|:|||.|:::|:..|.:...||..|:.:.|    ||....|.|.:::.| .:::|||.|    .
Zfish   163 FVADAYLGLFEVNPVTGEVKSLVSTEKRIAG----RRLGFVNDLDVTQDGKKVYFTDSSSRWQRR 223

  Fly   193 DFVFAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLKGS 256
            ||:.... |...||:..||...|...|:::.|.|.||:.|.|.|:.:::||||..|::|.::.|.
Zfish   224 DFMHLIMEATADGRVLEYDTETKEVNVMMENLRFPNGIQLFPDEESVLVAETTMARIKRVHVSGL 288

  Fly   257 RAGESEVFVEGLPGCPDNL-TADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVALMRL 320
            ..|..:.|:|.|||.|||: .:...|.||.:|....:...::...|:..|.|:..:.:|.:    
Zfish   289 NKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQRPWLKKLIFKLFS---- 349

  Fly   321 PLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLH---GFDRSASGISHVL 382
                                 .|.:::..|:.|.||.:..:|..|||.|   |...:.|..:|  
Zfish   350 ---------------------QDTLLKFVPRYSLVVELQSDGTCVRSFHDPQGLVSAYSSEAH-- 391

  Fly   383 EVKGHLYLGSPFNHYVAKVKL 403
            |..|||||||..:.|:.|:.|
Zfish   392 EYSGHLYLGSFRSPYLCKLDL 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 68/212 (32%)
Str_synth 174..256 CDD:304606 30/88 (34%)
apmapNP_997773.1 YvrE 73..>319 CDD:225921 80/252 (32%)
NHL 108..>281 CDD:302697 56/179 (31%)
NHL repeat 151..189 CDD:271320 14/39 (36%)
NHL repeat 196..252 CDD:271320 16/56 (29%)
Str_synth 200..287 CDD:304606 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C267939351
eggNOG 1 0.900 E1_COG1185
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4105
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D336287at33208
OrthoFinder 1 1.000 FOG0002859
OrthoInspector 1 1.000 T128773
orthoMCL 1 0.900 OOG5_130023
Panther 1 1.100 O PTHR10426
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3581
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.