DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and T12G3.4

DIOPT Version :8

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_502282.1 Gene:T12G3.4 / 178141 WormBaseID:WBGene00011739 Length:447 Species:Caenorhabditis elegans

Alignment Length:436 Identity:120/437 (27%)
Similarity:196/437 (45%) Gaps:66/437 (15%)


  Fly     4 LAALLKTSLFLVL-FLGSLFLLPVL------YPSTTFPFEQYFIKPARDLNGTLELNNHLNGARK 61
            |..|..|.:.:|| .||||.:..:|      .|.....|:   :.....|.|.|.:|..|..|..
 Worm    42 LRILGSTPVKIVLGLLGSLIIAGLLTNRIINAPIKAVEFD---LGDKIPLEGVLAVNKRLTDAEL 103

  Fly    62 LWKDQIFGPECLIVLE--DKIYTGIHSGEVIRLNNEESVQPITKIGQ------PCDYIFDD-ELC 117
            |..||::|||.|::.|  .|:|.|..:|.:..::.:|..:.|....|      .||..:.. .||
 Worm   104 LLVDQVYGPESLVLDEKNSKLYAGFKTGIIAEIDMKEGREKIVHAVQLAQGNHDCDGSYKKMNLC 168

  Fly   118 GYPVGLALDTQGNNLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRR-AKLFNSLVISRQ 181
            |.|:||.|...| .|:::|||.|::.::.:.:|...::.|.: ||....|.. .|..|.|.|...
 Worm   169 GRPLGLRLSDVG-ELVIADAYLGLFAINWQEEKVVKILGAGE-LPANNENAAPIKYLNDLDILPD 231

  Fly   182 GDIFWTDSFSE----DFVFAAFAN-PSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDF---- 237
            |.:.:|:|.::    ||:...|.: |:|||..||..||...||.|.|.|.||:.||..:..    
 Worm   232 GRVIFTESSTKFDDRDFILDLFEHRPNGRLLIYDPRKKDLRVLKDGLYFPNGVQLSIEKGMGKNA 296

  Fly   238 ---IILAETTAMRLRRYYLKGSRAGESEV----FVEGLPGCPDNLTADEEG-IWVPLSVASDSQN 294
               ::.:|....|:.:.::.......:.|    .:|.|||.|||:...:.| :.:|  :||....
 Worm   297 PWRVLYSEMGLARVMQIWVPRDHYSTAPVKTSPLIENLPGYPDNIRLTKSGHLLIP--IASHRSE 359

  Fly   295 PNLFAVLAPYPRLRSFLARLVALMRLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVD 359
            .:.|  |...|.:|.|:.::::...|.. |.|::                    |.....|::|:
 Worm   360 EDRF--LEQNPSVREFITKILSPQALGY-VANYV--------------------ADVEGLVIKVN 401

  Fly   360 W-NGNIVRSLHGFDRSASGISHVL-EVKGHLYLGSPFNHYVAKVKL 403
            . .|.|:.|.|........:|..: :.||.:.|||..|:|:|:.||
 Worm   402 TETGQIIESYHDQTGRVEAVSIAIDDGKGRMLLGSDVNYYIARAKL 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 64/229 (28%)
Str_synth 174..256 CDD:304606 28/94 (30%)
T12G3.4NP_502282.1 YvrE 112..>349 CDD:225921 69/239 (29%)
Str_synth 224..315 CDD:304606 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C267129210
eggNOG 1 0.900 E1_COG1185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5287
OMA 1 1.010
OrthoDB 1 1.010 D336287at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T98042
orthoMCL 1 0.900 OOG5_130023
Panther 1 1.100 O PTHR10426
Phylome 1 0.910 0.607 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.670

Return to query results.
Submit another query.