DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and apmap

DIOPT Version :9

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_002937496.1 Gene:apmap / 100485177 XenbaseID:XB-GENE-955295 Length:417 Species:Xenopus tropicalis


Alignment Length:413 Identity:126/413 - (30%)
Similarity:211/413 - (51%) Gaps:54/413 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFLVLFLGSLFLLPVLYPSTT------FPFEQYFIK----PARDLNGTLELNNHLNGARKLWKDQ 66
            :|..:|  :..:|.:|.|:..      .|.|..::.    |.  :.|.||.|..|..|::|::.:
 Frog    39 VFRTIF--TTLVLSILIPTVAAFWFLESPIEPQYLSFHTPPV--MTGVLEPNLKLRQAKRLYEGE 99

  Fly    67 IFGPECLIVLEDKIYTGIHSGEVIRLNNEESVQPITKIGQ-PCDYIFDDELCGYPVGLALDTQGN 130
            :.|||.|..:.|.::||...|::::: .:..:..|.::|: ||.:...:..||.|:||.:...| 
 Frog   100 LVGPESLANIGDVLFTGTADGQILKI-EDGKIHTIARLGKPPCGFREHEHTCGRPLGLRVGPNG- 162

  Fly   131 NLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQG-DIFWTDSFSE-- 192
            .|.|||||.||::|:..|....:||.::..:.||    .....|.|.::..| .|::|||.|:  
 Frog   163 TLYVSDAYQGIFEVNPVTGAVAMLVSSKVPVEGK----IMSFVNDLTVTSDGRKIYFTDSSSKWQ 223

  Fly   193 --DFVFAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLK 254
              |:.:... ....|||..||.|.|..:||:..|.||||:.|||:|||:::||||..|:||||:.
 Frog   224 RRDYPYLIMEGTDDGRLLEYDTVTKVVKVLMGGLRFANGVQLSPAEDFVLVAETTMARIRRYYVS 288

  Fly   255 GSRAGESEVFVEGLPGCPDNL-TADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVALM 318
            |...|.:::|||.:||.|||: .:...|.||.:|..  ..||. |:::       .||:....:.
 Frog   289 GLTKGGADMFVENMPGFPDNIRLSSSGGYWVAMSAV--RLNPG-FSMI-------DFLSDKPWIR 343

  Fly   319 RLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFD-RSASGISHVL 382
            |...::.:|               |.|::..|:.|.||.:...|:..||.|..: ..|:.||...
 Frog   344 RNVFKLFSH---------------DTVMQFVPRYSLVVEIGEKGSYKRSFHDPNGEVATFISEAH 393

  Fly   383 EVKGHLYLGSPFNHYVAKVKLPE 405
            |..|:||:||..:.::.::.|.:
 Frog   394 EHDGYLYMGSFRSPFICRLNLKD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 76/211 (36%)
Str_synth 174..256 CDD:304606 38/87 (44%)
apmapXP_002937496.1 YvrE 76..>321 CDD:225921 91/252 (36%)
Str_synth 202..289 CDD:354965 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D336287at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.