DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and apmap

DIOPT Version :8

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_002937496.1 Gene:apmap / 100485177 ID: Length:417 Species:Xenopus tropicalis

Alignment Length:413 Identity:126/414 (30%)
Similarity:211/414 (51%) Gaps:54/414 (13%)


  Fly    12 LFLVLFLGSLFLLPVLYPSTT------FPFEQYFIK----PARDLNGTLELNNHLNGARKLWKDQ 66
            :|..:|  :..:|.:|.|:..      .|.|..::.    |.  :.|.||.|..|..|::|::.:
 Frog    39 VFRTIF--TTLVLSILIPTVAAFWFLESPIEPQYLSFHTPPV--MTGVLEPNLKLRQAKRLYEGE 99

  Fly    67 IFGPECLIVLEDKIYTGIHSGEVIRLNNEESVQPITKIGQ-PCDYIFDDELCGYPVGLALDTQGN 130
            :.|||.|..:.|.::||...|::::: .:..:..|.::|: ||.:...:..||.|:||.:...| 
 Frog   100 LVGPESLANIGDVLFTGTADGQILKI-EDGKIHTIARLGKPPCGFREHEHTCGRPLGLRVGPNG- 162

  Fly   131 NLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQG-DIFWTDSFSE-- 192
            .|.|||||.||::|:..|....:||.::..:.||    .....|.|.::..| .|::|||.|:  
 Frog   163 TLYVSDAYQGIFEVNPVTGAVAMLVSSKVPVEGK----IMSFVNDLTVTSDGRKIYFTDSSSKWQ 223

  Fly   193 --DFVFAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLK 254
              |:.:... ....|||..||.|.|..:||:..|.||||:.|||:|||:::||||..|:||||:.
 Frog   224 RRDYPYLIMEGTDDGRLLEYDTVTKVVKVLMGGLRFANGVQLSPAEDFVLVAETTMARIRRYYVS 288

  Fly   255 GSRAGESEVFVEGLPGCPDNL-TADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVALM 318
            |...|.:::|||.:||.|||: .:...|.||.:|..  ..||. |:::       .||:....:.
 Frog   289 GLTKGGADMFVENMPGFPDNIRLSSSGGYWVAMSAV--RLNPG-FSMI-------DFLSDKPWIR 343

  Fly   319 RLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFD-RSASGISHVL 382
            |...::.:|               |.|::..|:.|.||.:...|:..||.|..: ..|:.||...
 Frog   344 RNVFKLFSH---------------DTVMQFVPRYSLVVEIGEKGSYKRSFHDPNGEVATFISEAH 393

  Fly   383 EVKGHLYLGSPFNHYVAKVKLPE 405
            |..|:||:||..:.::.::.|.:
 Frog   394 EHDGYLYMGSFRSPFICRLNLKD 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 77/212 (36%)
Str_synth 174..256 CDD:304606 39/88 (44%)
apmapXP_002937496.1 YvrE 76..>321 CDD:225921 91/253 (36%)
NHL <97..285 CDD:302697 68/194 (35%)
NHL repeat 103..135 CDD:271320 8/33 (24%)
NHL repeat 143..190 CDD:271320 18/48 (38%)
NHL repeat 200..249 CDD:271320 16/49 (33%)
Str_synth 202..289 CDD:304606 38/87 (44%)
NHL repeat 258..285 CDD:271320 17/27 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C267935555
eggNOG 1 0.900 E1_COG1185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D336287at33208
OrthoFinder 1 1.000 FOG0002859
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.