DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and uts2r5

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_001334493.1 Gene:uts2r5 ZFINID:ZDB-GENE-131121-337 Length:356 Species:Danio rerio

Alignment Length:313 Identity:95/314 (30%)
Similarity:155/314 (49%) Gaps:30/314 (10%)


  Fly    40 IVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNL--MIVNLAAADLMFVILCIPFTATDYMVY 102
            |:|....::.:.|..||:..:::|  |.::|.|.::  .|||||.|||:: :..|||....|...
Zfish    41 ILGTILTIMCLVGITGNVYTLIIV--NTSVRVTGSMYVYIVNLALADLLY-LSTIPFVVCTYFAK 102

  Fly   103 YWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPI----RSRMMRTENITLIAIVTLW 163
            .|.:|...||.:..|..||..|||:.|.:||.:|:||||:|:    |||..| ..:|.:    :|
Zfish   103 DWYFGDVGCRLLFSLDFVTMHASIFILTVMSTERYLAVVNPLDTFGRSRRYR-RAVTFL----VW 162

  Fly   164 IVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLYM 228
            :..|::::|.....|:.:  |....:...|| ..|......|.|....|.:..|.|.:||..||:
Zfish   163 LFSLILALPSMILIDLKI--DVHNGVEKRMC-HPTWQMTAYRVYLTVLFNTCILAPGLIIGYLYL 224

  Fly   229 RMIMRLWRQGTGVRMSKESQR-GRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIE--TNTLT 290
            ::....|...|.|..|:|.:| .:::|..::..:|:.:.:.:||..|..||.......  .::.|
Zfish   225 KLARIYWLSQTSVFPSREVKRCPKQKVLYMIFTIVLTYWACFLPFWLWQLLSIYYYAHGGLSSYT 289

  Fly   291 KLVIQVTAQTLAYSSSCINPLLYAFLSENFRK----------AFYKAVNCSSR 333
            .:.|......||||:|||||.||..|:.|:::          .|.|.|..||:
Zfish   290 VVYINFVVTCLAYSNSCINPFLYTLLTRNYQEYVRDRQKNSVEFKKRVRLSSQ 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 44/123 (36%)
7tm_1 55..313 CDD:278431 84/267 (31%)
uts2r5XP_001334493.1 7tm_1 56..312 CDD:278431 84/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.