DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and RGR

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_002912.2 Gene:RGR HGNCID:9990 Length:295 Species:Homo sapiens

Alignment Length:311 Identity:70/312 (22%)
Similarity:122/312 (39%) Gaps:48/312 (15%)


  Fly    41 VGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYY-- 103
            ||....|.|::|...|.|.|........:|:..:|::::||.|| ..:.|.....||..::..  
Human    19 VGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLALAD-SGISLNALVAATSSLLRVSH 82

  Fly   104 --WPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWI-V 165
              ||||...|::..:...|||.|||.:...::..|:    |...:|.....|..:..::.:|: .
Human    83 RRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRY----HHYCTRSQLAWNSAVSLVLFVWLSS 143

  Fly   166 VLVVSVP-VAFTHDVVVDYDAKKNITYGMCTFTTNDF-LGPRTYQVTFFISSYL---LPLMIISG 225
            ....::| :.:.|   .||:     ..|.|  .|.|: .|.|.:....|..|:.   :||.|...
Human   144 AFWAALPLLGWGH---YDYE-----PLGTC--CTLDYSKGDRNFTSFLFTMSFFNFAMPLFITIT 198

  Fly   226 LYMRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASL---WLPVQLILLLKSLDVIETN 287
            .|..|..:|.:.|                 .|.|...:...:|   |.|..::.|..   ||...
Human   199 SYSLMEQKLGKSG-----------------HLQVNTTLPARTLLLGWGPYAILYLYA---VIADV 243

  Fly   288 TLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSRYQNYT 338
            |.....:|:....:|.....||.:.||..:|...:..::.::...|.::.|
Human   244 TSISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRT 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 31/121 (26%)
7tm_1 55..313 CDD:278431 60/271 (22%)
RGRNP_002912.2 7tmA_Retinal_GPR 17..281 CDD:320200 68/297 (23%)
TM helix 1 18..44 CDD:320200 8/25 (32%)
TM helix 2 51..77 CDD:320200 8/27 (30%)
TM helix 3 92..122 CDD:320200 9/34 (26%)
TM helix 4 130..150 CDD:320200 2/20 (10%)
TM helix 5 177..206 CDD:320200 7/29 (24%)
TM helix 6 208..238 CDD:320200 7/47 (15%)
TM helix 7 248..273 CDD:320200 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56184566
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.