DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and ackr3

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001025605.1 Gene:ackr3 XenbaseID:XB-GENE-939861 Length:361 Species:Xenopus tropicalis

Alignment Length:349 Identity:89/350 (25%)
Similarity:151/350 (43%) Gaps:50/350 (14%)


  Fly     6 MLANISLNATRNEENITSFFTDEEWLAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMR 70
            :|.::|...|.|:.            |:..||..:..|.|    :.|...|.:||.:   |...:
 Frog    23 ILESLSCPNTLNKS------------ALLYTLAIVYIFIF----VMGLLANSMVIWL---NLQAK 68

  Fly    71 ST---TNLMIVNLAAADLMFVILCIPFTATDYMVY-YWPYGRFWCRSVQYLIVVTAFASIYTLVL 131
            :|   |:|.|.|||.|||. |:|.:|......:.: .||.|...|:....:..:..::||:.|..
 Frog    69 TTGYETHLYIFNLAIADLC-VLLTLPVWVVSLVQHNQWPMGEMTCKITHLVFSINLYSSIFFLTC 132

  Fly   132 MSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTF 196
            ||:||:|.|.....:...|.:.|..:..|.:|:|..|||:|..:....|  .....|.||....:
 Frog   133 MSVDRYLCVSLNGTAGQRRRKIIRRLVCVLVWLVAFVVSLPDTYYLKTV--SSPVTNETYCRSMY 195

  Fly   197 TTNDF----LGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQRGRKRVT-R 256
            ....|    ||   .::...:..:::|..||:..|   .:..|...:....|.:.:|   |:: |
 Frog   196 PEETFKEWLLG---MEIVSIMLGFVIPFPIIAIFY---CLLAWTLSSSSSSSGDQER---RISGR 251

  Fly   257 LVVVVVIAFASLWLPVQLILLLKSLDVIE-------TNTLTKLVIQVTAQTLAYSSSCINPLLYA 314
            |:|..|:.|...|||...:::|..:..::       .:......:.:| |..:....||||:||:
 Frog   252 LIVSYVVVFMVCWLPYHAMVILDVMSFLQLLPFSCFLDNFLYAALHIT-QCYSLLHCCINPILYS 315

  Fly   315 FLSENFRKAFYKAVNCSSRYQNYT 338
            |:..|:|....||.  ..||.:.|
 Frog   316 FIHRNYRYEIMKAF--IFRYSSKT 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 35/121 (29%)
7tm_1 55..313 CDD:278431 70/274 (26%)
ackr3NP_001025605.1 7tmA_ACKR3_CXCR7 40..325 CDD:320118 79/305 (26%)
TM helix 1 41..67 CDD:320118 9/33 (27%)
TM helix 2 74..98 CDD:320118 12/25 (48%)
TM helix 3 112..142 CDD:320118 10/30 (33%)
TM helix 4 155..176 CDD:320118 8/21 (38%)
TM helix 5 204..231 CDD:320118 6/33 (18%)
TM helix 6 244..274 CDD:320118 11/33 (33%)
TM helix 7 293..318 CDD:320118 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56150200
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.