DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and Rgr

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_067315.1 Gene:Rgr MGIID:1929473 Length:291 Species:Mus musculus

Alignment Length:324 Identity:71/325 (22%)
Similarity:128/325 (39%) Gaps:64/325 (20%)


  Fly    41 VGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWP 105
            ||....:.|::|...|.|.|.......::|:.:||::::||.||....:..: ..|...::..||
Mouse    19 VGTVLLMEALSGISLNGLTIFSFCKTPDLRTPSNLLVLSLALADTGISLNAL-VAAVSSLLRRWP 82

  Fly   106 YGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWI-VVLVV 169
            :|...|:...:....||.|||.....::..|:    |...:|.....:..:..::.:|: .....
Mouse    83 HGSEGCQVHGFQGFATALASICGSAAVAWGRY----HHYCTRRQLAWDTAIPLVLFVWMSSAFWA 143

  Fly   170 SVP-VAFTHDVVVDYDAKKNITYGMCTFTTNDF-LGPRT-----YQVTFFISSYLLPLMIISGLY 227
            |:| :.:.|   .||:     ..|.|  .|.|: .|.|.     :.:.||  ::|:||.|....|
Mouse   144 SLPLMGWGH---YDYE-----PVGTC--CTLDYSRGDRNFISFLFTMAFF--NFLVPLFITHTSY 196

  Fly   228 MRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASL---WLPVQLILLLKSL-DVIETNT 288
            ..|..:..|.|                 .|.|...:....|   |.|..|:.|..:: ||...:.
Mouse   197 RFMEQKFSRSG-----------------HLPVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISP 244

  Fly   289 LTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSRYQNYTSDLPPPRKTSCART 352
            ..::|..:.|:|:    ..||.:.|         |.::.:.|...:|..:     |:|:...||
Mouse   245 KLQMVPALIAKTM----PTINAINY---------ALHREMVCRGTWQCLS-----PQKSKKDRT 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 26/117 (22%)
7tm_1 55..313 CDD:278431 59/270 (22%)
RgrNP_067315.1 Csx17_I-U <38..>139 CDD:276221 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56148673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.