DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstA-R2 and MTNR1B

Sequence 1:NP_001263042.1 Gene:AstA-R2 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_005950.1 Gene:MTNR1B HGNCID:7464 Length:362 Species:Homo sapiens

Alignment Length:337 Identity:85/338 (25%)
Similarity:153/338 (45%) Gaps:53/338 (16%)


  Fly    38 PWIVGFFFGVIAIT---GFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDY 99
            ||:......|:.:|   ...|||||||.|:.|..:|:..||.:|:||.|||  |:...|:.....
Human    37 PWVAPALSAVLIVTTAVDVVGNLLVILSVLRNRKLRNAGNLFLVSLALADL--VVAFYPYPLILV 99

  Fly   100 MVYY--WPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTL 162
            .::|  |..|...|::..:::.::...|::.:..::|:|:..:.|.:....:.....|.:.|..:
Human   100 AIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLI 164

  Fly   163 WIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLY 227
            |::.:|..:|..|...  ::||.:   .|. |||...   ....|.....:..:|||:.::|..|
Human   165 WLLTVVALLPNFFVGS--LEYDPR---IYS-CTFIQT---ASTQYTAAVVVIHFLLPIAVVSFCY 220

  Fly   228 MRMIMRLWRQGTGVRMSKESQRGRKRVTRL------------VVVVVIAFASLWLPVQLILLLKS 280
                :|:|      .:..:::|..|..:||            :.||.:.||..|.|:..|.|..:
Human   221 ----LRIW------VLVLQARRKAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVA 275

  Fly   281 LDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAV--------NC------S 331
            ::..|........:.||:..|||.:||:|.::|..|::|||:. ||.:        :|      .
Human   276 INPQEMAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRRE-YKRILLALWNPRHCIQDASKG 339

  Fly   332 SRYQNYTSDLPP 343
            |..:...|..||
Human   340 SHAEGLQSPAPP 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 33/122 (27%)
7tm_1 55..313 CDD:278431 69/272 (25%)
MTNR1BNP_005950.1 7tm_4 48..>192 CDD:304433 40/152 (26%)
7tm_1 57..308 CDD:278431 69/272 (25%)
7tm_4 <131..>261 CDD:304433 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.